mirror of
https://github.com/aarnt/octopi.git
synced 2025-11-30 22:44:44 +01:00
Compare commits
2283 Commits
v0.1.6.1
...
6341f8ad9e
| Author | SHA1 | Date | |
|---|---|---|---|
|
|
6341f8ad9e | ||
|
|
8afef025a7 | ||
|
|
22791cdbda | ||
|
|
d8b4782142 | ||
|
|
d333d47760 | ||
|
|
5540fa8c1b | ||
|
|
252fce719c | ||
|
|
572bdabc3b | ||
|
|
45c472ae29 | ||
|
|
e4482c4be8 | ||
|
|
bb7cbee491 | ||
|
|
9f97fa93af | ||
|
|
f406cacd91 | ||
|
|
9ea4e2ced0 | ||
|
|
219539db7c | ||
|
|
d704996a71 | ||
|
|
cb555b10fa | ||
|
|
02d0413706 | ||
|
|
eba4b23398 | ||
|
|
3509f956d1 | ||
|
|
133a32d1bb | ||
|
|
a7846c9318 | ||
|
|
97dbbb0e28 | ||
|
|
8ec0c319e4 | ||
|
|
99ae4eea09 | ||
|
|
7ef564da38 | ||
|
|
46c163548c | ||
|
|
2cebca86ba | ||
|
|
19bff087c8 | ||
|
|
a6c6384888 | ||
|
|
8c89906b21 | ||
|
|
6c9af10ef0 | ||
|
|
46bbc195a0 | ||
|
|
73c7f7cfb8 | ||
|
|
6f35213ecc | ||
|
|
97c11f0f10 | ||
|
|
dec6656a44 | ||
|
|
0875030993 | ||
|
|
4fd9bc265c | ||
|
|
8781695048 | ||
|
|
4fa4562e65 | ||
|
|
196e282924 | ||
|
|
3fc49cb3aa | ||
|
|
ab31f28308 | ||
|
|
dc23455cce | ||
|
|
51f4d66d1a | ||
|
|
7aef1f07f8 | ||
|
|
1ff216543d | ||
|
|
275655ff61 | ||
|
|
5fefb275c2 | ||
|
|
6466b3604f | ||
|
|
93726ee571 | ||
|
|
0146c29419 | ||
|
|
e54977c340 | ||
|
|
5b3bc51990 | ||
|
|
7b365a1f14 | ||
|
|
e4fdedaf33 | ||
|
|
848239572d | ||
|
|
e1d9e85945 | ||
|
|
42a7c320d9 | ||
|
|
d03b5a84d0 | ||
|
|
1e6b2db303 | ||
|
|
a6785e9b7c | ||
|
|
c25ed66c0c | ||
|
|
4df0d961e6 | ||
|
|
aea5e70748 | ||
|
|
e9136182c9 | ||
|
|
86288068fa | ||
|
|
331bec30c8 | ||
|
|
7cae2d7586 | ||
|
|
1b202a25f8 | ||
|
|
fae056ec81 | ||
|
|
9dcf3ed14d | ||
|
|
f19e55220e | ||
|
|
6938c1f833 | ||
|
|
7208096fdc | ||
|
|
c4a9677667 | ||
|
|
0993cda3a0 | ||
|
|
8bed4c0e46 | ||
|
|
9fdd1a5e89 | ||
|
|
1cb421c284 | ||
|
|
20c2472aa1 | ||
|
|
dcb99d28ec | ||
|
|
d7e103388a | ||
|
|
1ec036202b | ||
|
|
a783507d60 | ||
|
|
b2c82af9f4 | ||
|
|
aaf1e5f6d6 | ||
|
|
197398e3bc | ||
|
|
38308ac0d0 | ||
|
|
e0e97795f3 | ||
|
|
0b02c78704 | ||
|
|
c7f101f67f | ||
|
|
ee70dc46a2 | ||
|
|
aafa8522ea | ||
|
|
b9b4913bbc | ||
|
|
cdc2013cbb | ||
|
|
04adf88088 | ||
|
|
a1d064fbe0 | ||
|
|
150763f0e3 | ||
|
|
c3afa378d1 | ||
|
|
70b8bc97ae | ||
|
|
256e862382 | ||
|
|
569e5fe133 | ||
|
|
0d7dd83354 | ||
|
|
241ae97423 | ||
|
|
11867b1ee6 | ||
|
|
603c477ef0 | ||
|
|
be52ee78a7 | ||
|
|
840aef9bb9 | ||
|
|
dfeb189940 | ||
|
|
07161db266 | ||
|
|
77f6ea88aa | ||
|
|
139950ab25 | ||
|
|
c22834118c | ||
|
|
e156b543f5 | ||
|
|
4d3278567b | ||
|
|
ce66ccbf03 | ||
|
|
f83f596ce8 | ||
|
|
9c047a024c | ||
|
|
d4a32751f3 | ||
|
|
ab9f709dc2 | ||
|
|
bcb2217f49 | ||
|
|
dce264509f | ||
|
|
927f208f78 | ||
|
|
93b42b40d4 | ||
|
|
3184a4b17e | ||
|
|
18b4d36f85 | ||
|
|
4c7f7e2b09 | ||
|
|
faa80775a5 | ||
|
|
7ab4e7fce5 | ||
|
|
cc105bf2e1 | ||
|
|
367e8ad750 | ||
|
|
6892f5f3c1 | ||
|
|
b23353a1f5 | ||
|
|
9986b1a2cb | ||
|
|
4d67fa44e4 | ||
|
|
993b95420f | ||
|
|
f4462b9379 | ||
|
|
c43d148dd7 | ||
|
|
a508fb7b11 | ||
|
|
6590909116 | ||
|
|
44df329672 | ||
|
|
96896f8a87 | ||
|
|
448c620c8a | ||
|
|
2ec8dbde08 | ||
|
|
48fc54d24b | ||
|
|
79dd707276 | ||
|
|
b1a6fb069c | ||
|
|
fb46f9acaa | ||
|
|
c86d07aac7 | ||
|
|
c1f24851ea | ||
|
|
771b7894ba | ||
|
|
aed9f6e27c | ||
|
|
f481213f69 | ||
|
|
ab61b62e6d | ||
|
|
dfb20233f8 | ||
|
|
9c7ed8cfaf | ||
|
|
3f25b41b31 | ||
|
|
3283bec5a5 | ||
|
|
ec61b6d688 | ||
|
|
b61d4601e2 | ||
|
|
938c2403e0 | ||
|
|
8f13832c20 | ||
|
|
2f2709faf1 | ||
|
|
c3fd32dc41 | ||
|
|
72287b3b88 | ||
|
|
4efd887252 | ||
|
|
ab08faaa5b | ||
|
|
6ca2083e03 | ||
|
|
2fb3fdc98f | ||
|
|
3853ca6ebd | ||
|
|
da166f3f12 | ||
|
|
caec196c2e | ||
|
|
190a7212eb | ||
|
|
3d14a55613 | ||
|
|
944b792fb6 | ||
|
|
35e7f07dda | ||
|
|
011e7f0ab3 | ||
|
|
0619e7abef | ||
|
|
5afd387086 | ||
|
|
9f8ca68053 | ||
|
|
6ef685235e | ||
|
|
71451bc6b2 | ||
|
|
981c27d5db | ||
|
|
d98b35416f | ||
|
|
036ad9fa9e | ||
|
|
742c0c9450 | ||
|
|
5e2bc3d28d | ||
|
|
aa79b18143 | ||
|
|
8b42b92441 | ||
|
|
ea20c392fe | ||
|
|
4fe3873793 | ||
|
|
d984e110cb | ||
|
|
307d00c930 | ||
|
|
ded9985f1d | ||
|
|
1737c189d6 | ||
|
|
fef6647228 | ||
|
|
22d8dbeb7b | ||
|
|
11f0244c14 | ||
|
|
e92ae9e2ad | ||
|
|
da22dd0494 | ||
|
|
da78109d95 | ||
|
|
cb75753731 | ||
|
|
a2ef33a2c9 | ||
|
|
9e78ec4399 | ||
|
|
9fd06ba0a6 | ||
|
|
ef303c9cbe | ||
|
|
5b95de1dc8 | ||
|
|
7ea04ad750 | ||
|
|
886b111b78 | ||
|
|
bbd78805bf | ||
|
|
a09e782ead | ||
|
|
10b51b1416 | ||
|
|
429bd605d4 | ||
|
|
a12054032a | ||
|
|
dcc00671ee | ||
|
|
49555c98ba | ||
|
|
94f489a0b1 | ||
|
|
91e00c84d2 | ||
|
|
1e3b31cc1c | ||
|
|
483064a956 | ||
|
|
8a3731b072 | ||
|
|
ebf4ad9df9 | ||
|
|
8aa2abe5ff | ||
|
|
ddd97fd5ba | ||
|
|
fe5df3e8a2 | ||
|
|
5bb8de6b6e | ||
|
|
3408bebc0c | ||
|
|
56641548d9 | ||
|
|
973fb2a473 | ||
|
|
fe4c704892 | ||
|
|
cb7b571dcc | ||
|
|
4afdd15784 | ||
|
|
53ea9fc062 | ||
|
|
e3d37d6f3d | ||
|
|
db9d26f858 | ||
|
|
e9c98087bc | ||
|
|
dff5d0ea9f | ||
|
|
6e7e3c6f4c | ||
|
|
bc44fa3d78 | ||
|
|
5cb760d1dc | ||
|
|
1ff9761e13 | ||
|
|
5d08cb59d6 | ||
|
|
33bdea2850 | ||
|
|
9887f40a08 | ||
|
|
8751898bd0 | ||
|
5af7cd8abc
|
|||
|
|
1dbebc4ccc | ||
|
|
cf0122f936 | ||
|
|
05a1d28850 | ||
|
|
99bc556cf3 | ||
|
|
8c508c91c8 | ||
|
|
e0708b73b6 | ||
|
|
aad8ac342e | ||
|
|
435f0281e5 | ||
|
|
a081ac2bfd | ||
|
|
d0fbc89b9e | ||
|
|
eebfa41342 | ||
|
|
a974769a4c | ||
|
|
69e85dddd2 | ||
|
|
4f6101f1af | ||
|
|
644c5a3d78 | ||
|
|
cd32995a81 | ||
|
|
64e72f06c9 | ||
|
|
9037688da5 | ||
|
|
8f9647e58f | ||
|
|
039824122b | ||
|
|
59c785f364 | ||
|
|
f79da34b3e | ||
|
|
b2e6dfc8a2 | ||
|
|
3397776586 | ||
|
|
d308c470eb | ||
|
|
a07a3a9b38 | ||
|
|
71759c8f7e | ||
|
|
b4301d72cc | ||
|
|
27f5df6aef | ||
|
|
0cddcd876d | ||
|
|
8a9465738d | ||
|
|
1416d16f49 | ||
|
|
d99839e7e9 | ||
|
|
2521696214 | ||
|
|
24a1423de0 | ||
|
|
6d97331ff2 | ||
|
|
f60d7d971e | ||
|
|
d8a1722d2a | ||
|
|
9085b6ca56 | ||
|
|
bebc5d1276 | ||
|
|
bbccd59fed | ||
|
|
1335406977 | ||
|
|
e7f783cc52 | ||
|
|
a4d718b8b7 | ||
|
|
1fa610f194 | ||
|
|
f59315cd60 | ||
|
|
712a43f39e | ||
|
|
7e3c26adbf | ||
|
|
030efb79b5 | ||
|
|
43b7e86f84 | ||
|
|
f403fd7f9a | ||
|
|
dfb0062aa0 | ||
|
|
455ae4853f | ||
|
|
8d7e4eac39 | ||
|
|
71dcb5fdcb | ||
|
|
7fdabbe9ef | ||
|
|
630f4efd17 | ||
|
|
4b12c8b06f | ||
|
|
c5f1e9694d | ||
|
|
cbd43ab731 | ||
|
|
1166691c37 | ||
|
|
e98fec0fb9 | ||
|
|
d0a30a9eca | ||
|
|
a92868cbb3 | ||
|
|
db36d56be9 | ||
|
|
2db10e3b4b | ||
|
|
3e3acfde39 | ||
|
|
a994beb935 | ||
|
|
144a8ca86e | ||
|
|
462bfec623 | ||
|
|
0a47127c71 | ||
|
|
ba9a934c7c | ||
|
|
d726e53976 | ||
|
|
06c42e047e | ||
|
|
5abd25ff76 | ||
|
|
15f33ee87c | ||
|
|
8b4db5bbd3 | ||
|
|
a4687d1a95 | ||
|
|
1a44290006 | ||
|
|
d16f189c72 | ||
|
|
3ce25e63c5 | ||
|
|
029ecfbedf | ||
|
|
1b8d9aca43 | ||
|
|
00b40f1a87 | ||
|
|
fd0307f033 | ||
|
|
0e9e3be096 | ||
|
|
18ed4434b0 | ||
|
|
3b03f26086 | ||
|
|
f73ff0c5ea | ||
|
|
b2507b5b74 | ||
|
|
31d1fd5896 | ||
|
|
96c29a1304 | ||
|
|
849bd94007 | ||
|
|
8ae9a89e88 | ||
|
|
4fd04ad81c | ||
|
|
8e9fe4a3c7 | ||
|
|
27d35b4ff3 | ||
|
|
242d1eae2f | ||
|
|
7ff4a64039 | ||
|
|
62127f516f | ||
|
|
2b7eead911 | ||
|
|
45edde8688 | ||
|
|
e238e4cdd0 | ||
|
|
aa86dff054 | ||
|
|
e5c7c85c81 | ||
|
|
040730e9a4 | ||
|
|
76a4ac7874 | ||
|
|
44a14d8eb1 | ||
|
|
d6db207676 | ||
|
|
6dd83e5e53 | ||
|
|
f0ee8c6e03 | ||
|
|
91eff99690 | ||
|
|
7cd3f9b96a | ||
|
|
ce98289abd | ||
|
|
d3a6e85c68 | ||
|
|
74b4a79974 | ||
|
|
79f5d61972 | ||
|
|
b974aff871 | ||
|
|
31980010af | ||
|
|
6fd963066f | ||
|
|
f5b16db539 | ||
|
|
cc27dcadec | ||
|
|
5170d1658c | ||
|
|
d2ea008331 | ||
|
|
06cbf74d32 | ||
|
|
d7330ed2f0 | ||
|
|
29525448bc | ||
|
|
52ba603816 | ||
|
|
173d7f08ef | ||
|
|
733b4abdb5 | ||
|
|
7572eb55f2 | ||
|
|
97d9f23d5a | ||
|
|
c4feb158a8 | ||
|
|
539b708460 | ||
|
|
6e0ba4db3b | ||
|
|
a8628f05d8 | ||
|
|
05eda76963 | ||
|
|
0df51acc45 | ||
|
|
0d8fbdfa18 | ||
|
|
09e654469f | ||
|
|
b24e82c0ca | ||
|
|
fbc98fcf92 | ||
|
|
7bd9c32887 | ||
|
|
d8ce53ef5c | ||
|
|
0fe112410c | ||
|
|
7bb69677ab | ||
|
|
33b937e082 | ||
|
|
25de491e20 | ||
|
|
22a0fcbb90 | ||
|
|
f063177f2c | ||
|
|
794c27c4c9 | ||
|
|
f5b9270bbd | ||
|
|
7c35dfd845 | ||
|
|
c87555e0be | ||
|
|
f483aa60f7 | ||
|
|
fe6dee7723 | ||
|
|
bfc98aebdb | ||
|
|
baa7259340 | ||
|
|
1c59c599c7 | ||
|
|
8f1ca44eb2 | ||
|
|
1dffe7e231 | ||
|
|
1998da1cf0 | ||
|
|
085e9be8ae | ||
|
|
c0ffbf1422 | ||
|
|
900d49c227 | ||
|
|
8bb9ebc512 | ||
|
|
3f47c2127c | ||
|
|
f0a7fef072 | ||
|
|
16fd585d2e | ||
|
|
5469925a40 | ||
|
|
c9f21b2d5c | ||
|
|
d6a6ecc504 | ||
|
|
c900d85241 | ||
|
|
80508a3df4 | ||
|
|
f98f74447b | ||
|
|
2909208e97 | ||
|
|
30b938cc17 | ||
|
|
a63d970ae3 | ||
|
|
622c041e3b | ||
|
|
a96ad4190b | ||
|
|
c503c6cce0 | ||
|
|
1234d31bc6 | ||
|
|
46ac37fc4a | ||
|
|
c4739bd5c9 | ||
|
|
ac0ee5df2f | ||
|
|
3f5594e143 | ||
|
|
224665bf29 | ||
|
|
ac2990ab15 | ||
|
|
84ebf2d239 | ||
|
|
d4289dc66b | ||
|
|
d0bed2979a | ||
|
|
d128b0e8ac | ||
|
|
698423dba9 | ||
|
|
2ee7414b0e | ||
|
|
b49b52a26a | ||
|
|
f147678491 | ||
|
|
5b8dfb0388 | ||
|
|
50e1c6bb85 | ||
|
|
4805a95ff8 | ||
|
|
c5688495c0 | ||
|
|
400c4750fd | ||
|
|
ab8af8bc6e | ||
|
|
bb06f38da9 | ||
|
|
7f15a34bc9 | ||
|
|
8e9e0d05e9 | ||
|
|
a85d8af58f | ||
|
|
241f9e7241 | ||
|
|
b5fda06f3e | ||
|
|
ded5f7313a | ||
|
|
cda6193af7 | ||
|
|
d23117a714 | ||
|
|
226d0425c4 | ||
|
|
70d6220f4e | ||
|
|
a6349334a1 | ||
|
|
9f228d393a | ||
|
|
8599400779 | ||
|
|
eef29fb556 | ||
|
|
773caf0e0c | ||
|
|
70f1445df5 | ||
|
|
d35f3759a9 | ||
|
|
590c4143e1 | ||
|
|
42e8e4ed2b | ||
|
|
6563139418 | ||
|
|
6209e80e4c | ||
|
|
5e1e70666e | ||
|
|
4c93c474ff | ||
|
|
e5ef5085e5 | ||
|
|
3b94072502 | ||
|
|
535c70e695 | ||
|
|
0d1a835f66 | ||
|
|
36f5c818d1 | ||
|
|
e8794007d6 | ||
|
|
033b327ee6 | ||
|
|
9258b3a252 | ||
|
|
beb8d45dac | ||
|
|
34d38280ff | ||
|
|
e553367f22 | ||
|
|
a7cf805cda | ||
|
|
fd1b3516f4 | ||
|
|
6e05037eb9 | ||
|
|
5845f49b79 | ||
|
|
d7c2d23dfa | ||
|
|
6bebce8693 | ||
|
|
483bdf85e1 | ||
|
|
4ae0c6f436 | ||
|
|
3da5a4eac5 | ||
|
|
83087072c2 | ||
|
|
268dea6272 | ||
|
|
b966faa0dd | ||
|
|
2f96f12386 | ||
|
|
3e50690e0c | ||
|
|
c53774609b | ||
|
|
e3f626da8f | ||
|
|
ce1821f8dd | ||
|
|
ecc737d336 | ||
|
|
e553a4f045 | ||
|
|
cfb04970a8 | ||
|
|
bd7d92d18b | ||
|
|
cc9811b6de | ||
|
|
746bb9d7da | ||
|
|
a3f84b1573 | ||
|
|
7a63e3fc2f | ||
|
|
885ec83b23 | ||
|
|
91fdfc8c47 | ||
|
|
aa71f64d95 | ||
|
|
188f71b46b | ||
|
|
9825be81b4 | ||
|
|
20f4eb2810 | ||
|
|
79a7f4f698 | ||
|
|
039f98130d | ||
|
|
c780060214 | ||
|
|
a34ba69c24 | ||
|
|
af881e7912 | ||
|
|
93f3c74a59 | ||
|
|
db058e35f5 | ||
|
|
d1347b1820 | ||
|
|
33ceb0178f | ||
|
|
baeb542b38 | ||
|
|
fd787a74fc | ||
|
|
e60c516177 | ||
|
|
b32e94e0ce | ||
|
|
67f6692a48 | ||
|
|
0ad770c83e | ||
|
|
05a891b2a6 | ||
|
|
a1ed637f31 | ||
|
|
8ae7a0fd8f | ||
|
|
42064d75df | ||
|
|
064cb3ded3 | ||
|
|
5d36b8a957 | ||
|
|
f6961a89ca | ||
|
|
2d9c34fa18 | ||
|
|
aed6d3948a | ||
|
|
c19a324cda | ||
|
|
614e3b8bd3 | ||
|
|
a575a04981 | ||
|
|
b4899bcedc | ||
|
|
e159abaafc | ||
|
|
e55090a066 | ||
|
|
ec89b8a2bc | ||
|
|
95faab97a9 | ||
|
|
a7108f0835 | ||
|
|
48bf47fa48 | ||
|
|
2a5f9b32b6 | ||
|
|
208f689118 | ||
|
|
f7f34a6562 | ||
|
|
ad8732ef81 | ||
|
|
b432c40c26 | ||
|
|
3d1b4678bc | ||
|
|
363374f639 | ||
|
|
8141393314 | ||
|
|
76330f8b17 | ||
|
|
7da9c3edc0 | ||
|
|
f5b22fba98 | ||
|
|
8defc3bdd0 | ||
|
|
71238d3e93 | ||
|
|
121ad0d634 | ||
|
|
ad28a0678f | ||
|
|
3db8415077 | ||
|
|
6c3b63f98f | ||
|
|
f3a14edab0 | ||
|
|
043931eb2a | ||
|
|
1c578367b7 | ||
|
|
28e4c0f989 | ||
|
|
46535831d3 | ||
|
|
d1048abc9f | ||
|
|
8dcc30ca9e | ||
|
|
b87ed8345b | ||
|
|
4b3507539c | ||
|
|
6008d37c19 | ||
|
|
6b601439cc | ||
|
|
0dad821102 | ||
|
|
739397211e | ||
|
|
5bb1faa43b | ||
|
|
524f305cc2 | ||
|
|
c56d777c96 | ||
|
|
8e8decae26 | ||
|
|
e727c8e598 | ||
|
|
275d159d81 | ||
|
|
a2802044a6 | ||
|
|
218f27bce0 | ||
|
|
10c97c96c3 | ||
|
|
0066009d11 | ||
|
|
e46899b4f5 | ||
|
|
ed61820026 | ||
|
|
3db8927f28 | ||
|
|
1eff031e23 | ||
|
|
e2c87e2c50 | ||
|
|
58797754eb | ||
|
|
88590ec964 | ||
|
|
c770253981 | ||
|
|
67dc305cc9 | ||
|
|
a4454951e4 | ||
|
|
4fdcb953e8 | ||
|
|
11e437b5b5 | ||
|
|
3dc3fa73ec | ||
|
|
dad4f38804 | ||
|
|
bb0bc7b3f2 | ||
|
|
46ef3655c1 | ||
|
|
11010fbf23 | ||
|
|
af1d5829c9 | ||
|
|
abccec8324 | ||
|
|
70b36e25df | ||
|
|
94d368337f | ||
|
|
36ffdbaa86 | ||
|
|
ec48262a24 | ||
|
|
2dd6888d28 | ||
|
|
b21774789d | ||
|
|
f7f8067263 | ||
|
|
f491a77ee0 | ||
|
|
0d86bc1e2f | ||
|
|
cd2cc7045e | ||
|
|
ff65bad532 | ||
|
|
4a366da7d9 | ||
|
|
64b143b843 | ||
|
|
ff7f108e58 | ||
|
|
95d8882854 | ||
|
|
fa4451316c | ||
|
|
1ead404fac | ||
|
|
af48197cdc | ||
|
|
22c807eb00 | ||
|
|
c25660d304 | ||
|
|
292506e020 | ||
|
|
dab4844ebe | ||
|
|
cd3df70032 | ||
|
|
6817c63d83 | ||
|
|
071d489af0 | ||
|
|
a433ea673f | ||
|
|
fe0a38b7fc | ||
|
|
9e32b7846c | ||
|
|
ce8eb46a69 | ||
|
|
05f3607fb2 | ||
|
|
99f737e3cc | ||
|
|
2d0ffd8174 | ||
|
|
9f7ff44164 | ||
|
|
316a91d102 | ||
|
|
000c00b346 | ||
|
|
fae53c8d6e | ||
|
|
23c0ada511 | ||
|
|
a812cf5316 | ||
|
|
6742daf14c | ||
|
|
61b77290fe | ||
|
|
6a0a8002d9 | ||
|
|
5d49c4bd96 | ||
|
|
1072a3612f | ||
|
|
3fece6a554 | ||
|
|
d459833b44 | ||
|
|
0f217461a2 | ||
|
|
926c7ef117 | ||
|
|
9f90ed5f76 | ||
|
|
ca6826b3d7 | ||
|
|
846615374f | ||
|
|
e9e7ca3df8 | ||
|
|
cf7e52d71e | ||
|
|
1f384616c7 | ||
|
|
8b99edab3e | ||
|
|
10f7c2307c | ||
|
|
505621cc6d | ||
|
|
d9f6e6da92 | ||
|
|
a05add18cd | ||
|
|
fd5dcc07fa | ||
|
|
f67e3f27e8 | ||
|
|
b838d2fa26 | ||
|
|
e846990877 | ||
|
|
2250904a90 | ||
|
|
6500cb9e2e | ||
|
|
66311c1f4d | ||
|
|
dd261f4ed2 | ||
|
|
0d2ea072ca | ||
|
|
c6293bf567 | ||
|
|
622631bb1c | ||
|
|
5438954d7c | ||
|
|
7931b5f626 | ||
|
|
a32d8c6193 | ||
|
|
2cde060e2f | ||
|
|
64e82a2f34 | ||
|
|
0d322a718e | ||
|
|
00e3ee492f | ||
|
|
da2f616509 | ||
|
|
81fbb39c35 | ||
|
|
2334d2684e | ||
|
|
63bb50a602 | ||
|
|
e187d54d0b | ||
|
|
26029b124d | ||
|
|
4dc4a42570 | ||
|
|
69706789e2 | ||
|
|
337dc296ac | ||
|
|
fddcbc72b5 | ||
|
|
c6a5028306 | ||
|
|
791cc24d1e | ||
|
|
b741c49f2d | ||
|
|
8b83830c15 | ||
|
|
c4cec0b122 | ||
|
|
74a519472a | ||
|
|
e452f82542 | ||
|
|
c67771698a | ||
|
|
fa9f4ce1c7 | ||
|
|
c0538bd1ba | ||
|
|
6a91e57b58 | ||
|
|
4b5887b232 | ||
|
|
6046669135 | ||
|
|
aa4d30261b | ||
|
|
b8bf9495d0 | ||
|
|
4f7822b4fb | ||
|
|
2910f6ad34 | ||
|
|
f41beff873 | ||
|
|
31fb2dac94 | ||
|
|
7424ba3d60 | ||
|
|
26e5cd3514 | ||
|
|
0a7f7c782e | ||
|
|
5d6a3af63b | ||
|
|
90b237b9c8 | ||
|
|
dd71f2df80 | ||
|
|
c9be44ab2f | ||
|
|
6642916612 | ||
|
|
4dae7f8af4 | ||
|
|
894928eed3 | ||
|
|
3f8a5a6bd5 | ||
|
|
784fc6f20e | ||
|
|
f5d49c6ef6 | ||
|
|
9c8617d452 | ||
|
|
0867327d2a | ||
|
|
4df7758e82 | ||
|
|
25965581ab | ||
|
|
33b72056a9 | ||
|
|
ffc984824d | ||
|
|
5cccfce28e | ||
|
|
fe27630042 | ||
|
|
29180a1040 | ||
|
|
24789355be | ||
|
|
edb0f4b369 | ||
|
|
91b6dd48fe | ||
|
|
f667d025c5 | ||
|
|
7131a6bc84 | ||
|
|
9d60096df9 | ||
|
|
494403333b | ||
|
|
8c25a5299d | ||
|
|
c51789c892 | ||
|
|
6bdef66282 | ||
|
|
7796ad2a55 | ||
|
|
5241d0f58c | ||
|
|
f09c7753ab | ||
|
|
92a42d5c9b | ||
|
|
06b3f8c6b1 | ||
|
|
700809bc77 | ||
|
|
ca8196007c | ||
|
|
698ce813c1 | ||
|
|
6ad8d296ad | ||
|
|
b8a781e3c4 | ||
|
|
0f4d0d2cde | ||
|
|
195aca81bb | ||
|
|
162b31ef2a | ||
|
|
d076398cce | ||
|
|
abeee87c69 | ||
|
|
836cb01391 | ||
|
|
529a867a95 | ||
|
|
4b719f5106 | ||
|
|
b9cfee3163 | ||
|
|
5e9cd21f2b | ||
|
|
9eb1faa8ca | ||
|
|
a3e53728e3 | ||
|
|
c1dd1dd669 | ||
|
|
2623504bc8 | ||
|
|
6caaef4b9a | ||
|
|
7b3ccfb67d | ||
|
|
377bbc702a | ||
|
|
f388a9cc8c | ||
|
|
a3707b857d | ||
|
|
23323442f2 | ||
|
|
8f13211b8b | ||
|
|
c9a8e2156f | ||
|
|
614850f056 | ||
|
|
4fe304e5bf | ||
|
|
20e6874771 | ||
|
|
2610359c29 | ||
|
|
24099a0892 | ||
|
|
04127c4ab9 | ||
|
|
296a7848b4 | ||
|
|
041688a996 | ||
|
|
46f5efb418 | ||
|
|
abc5e76913 | ||
|
|
15899fccbd | ||
|
|
b048c1c002 | ||
|
|
a38b24afc4 | ||
|
|
8c50c14fe0 | ||
|
|
01b5e3c01b | ||
|
|
1b92868b15 | ||
|
|
0e8805e5eb | ||
|
|
661d28956b | ||
|
|
cdead9468c | ||
|
|
9aad3f97b6 | ||
|
|
002fd0180e | ||
|
|
245db0572a | ||
|
|
f913972868 | ||
|
|
db2eecd8bc | ||
|
|
3f912fe637 | ||
|
|
0e7a6c15a7 | ||
|
|
5eb575e496 | ||
|
|
b93df38efa | ||
|
|
bbe56f6f2d | ||
|
|
149517e436 | ||
|
|
907432c0b3 | ||
|
|
b5c7526cea | ||
|
|
de8019d8fc | ||
|
|
aacec874d7 | ||
|
|
b5dd3922a3 | ||
|
|
ed4a1d8f21 | ||
|
|
2a2eb93187 | ||
|
|
4eaed8dba6 | ||
|
|
4b0703ece5 | ||
|
|
b3c5378920 | ||
|
|
2b4b20b9fa | ||
|
|
3e4db580eb | ||
|
|
091f0a12b6 | ||
|
|
8ccc3016c7 | ||
|
|
0f17fb16c4 | ||
|
|
8890a7cb87 | ||
|
|
4a273bd826 | ||
|
|
f4c3222174 | ||
|
|
1d44a52981 | ||
|
|
ccabf3d4e9 | ||
|
|
ed0a6c8b82 | ||
|
|
044bf6c594 | ||
|
|
af37001a64 | ||
|
|
84810b9a97 | ||
|
|
f7e5e6ed7b | ||
|
|
95ff43b71d | ||
|
|
1ecdba57bd | ||
|
|
7c5e3f9f27 | ||
|
|
87b0a8e7af | ||
|
|
930b4c023f | ||
|
|
13848f9525 | ||
|
|
0f43222795 | ||
|
|
a88a20775d | ||
|
|
d04cf46c61 | ||
|
|
0bec405a61 | ||
|
|
99a2fb5c8f | ||
|
|
274da64555 | ||
|
|
ed43e44883 | ||
|
|
01ea313e93 | ||
|
|
ee03eb4a67 | ||
|
|
bf615b96a7 | ||
|
|
ce1374844a | ||
|
|
6f191e2dba | ||
|
|
07cd087d9e | ||
|
|
bc659f50dc | ||
|
|
98c4b4dc70 | ||
|
|
7a0ff75fba | ||
|
|
c2b1c84268 | ||
|
|
12b34017e7 | ||
|
|
d76eb8b1c8 | ||
|
|
9a679424d7 | ||
|
|
6855629524 | ||
|
|
87206bbcc8 | ||
|
|
395291481a | ||
|
|
2a5fe191b0 | ||
|
|
c5d39dae42 | ||
|
|
2f601d3650 | ||
|
|
f3128bf86d | ||
|
|
b4d38db487 | ||
|
|
f9aa8573a5 | ||
|
|
31060ae2b2 | ||
|
|
72a922a080 | ||
|
|
d23565750a | ||
|
|
841a0310cf | ||
|
|
198cc22caf | ||
|
|
bf229e28ce | ||
|
|
c780fddb47 | ||
|
|
43ed522fa8 | ||
|
|
d79b079677 | ||
|
|
b0448a4bd7 | ||
|
|
e0792d776f | ||
|
|
45941fa780 | ||
|
|
fdcb59ae4a | ||
|
|
ed2100c40f | ||
|
|
6d55356219 | ||
|
|
7b6b8d79b1 | ||
|
|
29860a0d80 | ||
|
|
954419baa3 | ||
|
|
8b05da2c3b | ||
|
|
ef3e5c6197 | ||
|
|
306b846b9d | ||
|
|
5d54c1f28f | ||
|
|
4b883b4870 | ||
|
|
2f5c563236 | ||
|
|
f94ee1a04b | ||
|
|
1060b3c800 | ||
|
|
1717ec4ceb | ||
|
|
ddb1131ea8 | ||
|
|
8fa0f1d4b8 | ||
|
|
7b81db5ce1 | ||
|
|
3d9dbfb5fa | ||
|
|
18ce8177f7 | ||
|
|
2145455c12 | ||
|
|
882f876e2b | ||
|
|
ab87f72781 | ||
|
|
b3c67e5d8f | ||
|
|
abc15557d9 | ||
|
|
8b1e670281 | ||
|
|
499cbbe9b9 | ||
|
|
31555d6bc4 | ||
|
|
7a32ba9ea2 | ||
|
|
a1775be6b0 | ||
|
|
22b89268c0 | ||
|
|
c1d60de3cc | ||
|
|
b550b4d7bf | ||
|
|
2e577dbbb2 | ||
|
|
b21ad34f77 | ||
|
|
4e9028462e | ||
|
|
24e73b68c9 | ||
|
|
c1c8d8e91a | ||
|
|
a6e171abee | ||
|
|
67ded2c136 | ||
|
|
85acca454f | ||
|
|
679477296f | ||
|
|
62a443dc31 | ||
|
|
67bfc99983 | ||
|
|
4fb2ea22f4 | ||
|
|
94d1cd3c27 | ||
|
|
178bbc1751 | ||
|
|
743f85015a | ||
|
|
ff8c2c8435 | ||
|
|
82f525c21e | ||
|
|
941e467b93 | ||
|
|
5e6be67cc9 | ||
|
|
34c446fc29 | ||
|
|
0ee7ca1a74 | ||
|
|
408cbd6446 | ||
|
|
535f2c1839 | ||
|
|
ec43d1ef12 | ||
|
|
0848e2f75e | ||
|
|
cd68e45ac4 | ||
|
|
957d4e8a03 | ||
|
|
27d053f5fb | ||
|
|
16f5d0deeb | ||
|
|
81c2232609 | ||
|
|
2f64c66b63 | ||
|
|
76ee38a2d3 | ||
|
|
fe495319e2 | ||
|
|
f33ec2cc48 | ||
|
|
3e5257cae9 | ||
|
|
c7eb428c9e | ||
|
|
63610228f2 | ||
|
|
1cc1036468 | ||
|
|
adfd514772 | ||
|
|
79731ccb69 | ||
|
|
9cb3f72a9b | ||
|
|
1dba4e4565 | ||
|
|
9600933b63 | ||
|
|
ec5a01925f | ||
|
|
d0a55bba67 | ||
|
|
df6f0467a5 | ||
|
|
3d6f0723f5 | ||
|
|
3ee20b8b76 | ||
|
|
359584ba93 | ||
|
|
fa8083599a | ||
|
|
25971985ee | ||
|
|
b0613be2a2 | ||
|
|
241169308a | ||
|
|
58757a23a2 | ||
|
|
e062b9c5f8 | ||
|
|
ead4189904 | ||
|
|
cdbaccaadd | ||
|
|
80414e2177 | ||
|
|
b7fa1be650 | ||
|
|
f46d16ca03 | ||
|
|
7d7910f934 | ||
|
|
6a5637023f | ||
|
|
251822c887 | ||
|
|
553068128b | ||
|
|
aea5e2cf09 | ||
|
|
91dfad1faf | ||
|
|
6f2401e10a | ||
|
|
72c0a0ba11 | ||
|
|
fa7e88d370 | ||
|
|
3935abcd82 | ||
|
|
10c78af877 | ||
|
|
2d2b29f0d0 | ||
|
|
45fa9697ad | ||
|
|
f0bf295aab | ||
|
|
17123d9428 | ||
|
|
b9f0c6b73c | ||
|
|
a64adfb404 | ||
|
|
f192bc7aa6 | ||
|
|
1c07b57afa | ||
|
|
e054cb0218 | ||
|
|
5009ee232c | ||
|
|
78604ed1f6 | ||
|
|
42918df4a3 | ||
|
|
cafc92e030 | ||
|
|
be5fa78234 | ||
|
|
cb16ea67de | ||
|
|
ab5866427e | ||
|
|
b9654265f9 | ||
|
|
598eff9abd | ||
|
|
73b1028fe8 | ||
|
|
abe3060ea9 | ||
|
|
2b644de025 | ||
|
|
ba802c6a7d | ||
|
|
2555fa645b | ||
|
|
96300a0491 | ||
|
|
d454c7e8f4 | ||
|
|
e1954e0821 | ||
|
|
36aff057a5 | ||
|
|
70a68fde41 | ||
|
|
6af126c47c | ||
|
|
7d5db3e3c7 | ||
|
|
3547036a00 | ||
|
|
3988003c17 | ||
|
|
1e585a9876 | ||
|
|
5a2e61ba13 | ||
|
|
3460389d2f | ||
|
|
0a599bfb0e | ||
|
|
d084dc016a | ||
|
|
66b9e7ee1f | ||
|
|
c413caadd1 | ||
|
|
bff4de2189 | ||
|
|
a9d9eb30d3 | ||
|
|
f9063cf252 | ||
|
|
61f6a199e9 | ||
|
|
e59fe5ac8c | ||
|
|
ee79c35b62 | ||
|
|
a3b1eaf68b | ||
|
|
9a419e5ab6 | ||
|
|
8f82f46852 | ||
|
|
f45a5a903a | ||
|
|
6b727bf114 | ||
|
|
2fad59554b | ||
|
|
e8c3ff875c | ||
|
|
12b7338b51 | ||
|
|
c615f97362 | ||
|
|
d36e793864 | ||
|
|
f6fd67a33e | ||
|
|
b9958cafc9 | ||
|
|
3849c5ad31 | ||
|
|
60bd2cd082 | ||
|
|
f9692ddd48 | ||
|
|
5e29bc7145 | ||
|
|
845311daf2 | ||
|
|
d35247c92a | ||
|
|
e8613527b6 | ||
|
|
c053cf21a6 | ||
|
|
e46725e998 | ||
|
|
27de3460cb | ||
|
|
c067a37787 | ||
|
|
6bc18dd768 | ||
|
|
c9dbaebec4 | ||
|
|
640d5633b4 | ||
|
|
b3887c8138 | ||
|
|
14c69b0b53 | ||
|
|
13218919aa | ||
|
|
465e23f98d | ||
|
|
b578189f0d | ||
|
|
fb7a1f9d6b | ||
|
|
3e3c6ae0fc | ||
|
|
eca942ec96 | ||
|
|
ff6c3c74e6 | ||
|
|
9c886b1800 | ||
|
|
52e111f5ab | ||
|
|
669e85b63d | ||
|
|
035cd35ada | ||
|
|
fbe16eea44 | ||
|
|
dab1bc3752 | ||
|
|
b48f4896e7 | ||
|
|
82acc74c24 | ||
|
|
8b4721320e | ||
|
|
d0ec92cd24 | ||
|
|
1759559de0 | ||
|
|
98c91ae853 | ||
|
|
a401e12573 | ||
|
|
2f45944be4 | ||
|
|
76aa51fa2e | ||
|
|
28d85c366a | ||
|
|
3e303ce310 | ||
|
|
e08f7a8815 | ||
|
|
91e559e35f | ||
|
|
5d6c5771cb | ||
|
|
24cb7b2eaf | ||
|
|
69fd73301b | ||
|
|
3d6928a391 | ||
|
|
f56bbbc168 | ||
|
|
673167059c | ||
|
|
365ddc48ea | ||
|
|
cda91af947 | ||
|
|
2fb2266d96 | ||
|
|
0f77565fdb | ||
|
|
05c03ebdec | ||
|
|
c346876f94 | ||
|
|
497cc66ea4 | ||
|
|
dfddcdcdcb | ||
|
|
139f3642aa | ||
|
|
b6aab3a315 | ||
|
|
329fae945d | ||
|
|
d14bb8ea31 | ||
|
|
23f0205037 | ||
|
|
4ad97ac0a1 | ||
|
|
2d6d0f76b4 | ||
|
|
ca25f656cb | ||
|
|
1fbcb598ce | ||
|
|
67e2e1f246 | ||
|
|
bb8636c5ee | ||
|
|
1f4cee54f6 | ||
|
|
7cd00bbc05 | ||
|
|
08b7ec4999 | ||
|
|
e8779ccbf6 | ||
|
|
f94457f12c | ||
|
|
e9c6174942 | ||
|
|
d6fcc3cf56 | ||
|
|
b09b9de684 | ||
|
|
ff118927ed | ||
|
|
c36eb4095d | ||
|
|
50a8036f4d | ||
|
|
930fc5ac77 | ||
|
|
fb0947ae7c | ||
|
|
967a6328f9 | ||
|
|
8ae9b55214 | ||
|
|
be36c2937b | ||
|
|
0dde2ab86e | ||
|
|
d54d3d8cd0 | ||
|
|
22622a7d71 | ||
|
|
e0817e2fb0 | ||
|
|
f3898716f3 | ||
|
|
4eaca6c9b3 | ||
|
|
f09bfc7003 | ||
|
|
d5d756d82d | ||
|
|
941aece11e | ||
|
|
21953d09d4 | ||
|
|
9e4fa4b7a3 | ||
|
|
347bd0ceb1 | ||
|
|
b8747195ed | ||
|
|
8800c47f55 | ||
|
|
e9773c1c86 | ||
|
|
5289caadff | ||
|
|
dd04860401 | ||
|
|
eed57cf144 | ||
|
|
6e0ebe9fc0 | ||
|
|
404a156f2b | ||
|
|
a699915ea7 | ||
|
|
fbc4b54811 | ||
|
|
a4de722874 | ||
|
|
c82f3c02fc | ||
|
|
17101da9b2 | ||
|
|
ccb1418a34 | ||
|
|
0864632d9e | ||
|
|
7ca2f7e93e | ||
|
|
be162818cb | ||
|
|
a1759d85fa | ||
|
|
af32397c04 | ||
|
|
d74618d332 | ||
|
|
5c9be7cbd1 | ||
|
|
4121c1e2a9 | ||
|
|
11fd4530ce | ||
|
|
b456284f75 | ||
|
|
122ae6a6ff | ||
|
|
e09727b56d | ||
|
|
10c114a867 | ||
|
|
a6bcf4ddbf | ||
|
|
b7936681cf | ||
|
|
e232c0bb5e | ||
|
|
e235be9895 | ||
|
|
95d5debfee | ||
|
|
a274a3d9ae | ||
|
|
51e8d51562 | ||
|
|
3ddf0118fc | ||
|
|
31f980ff4f | ||
|
|
dfb0dbfa90 | ||
|
|
9d566cc6c1 | ||
|
|
0c2d4dddd5 | ||
|
|
e34c251523 | ||
|
|
8325cb6b43 | ||
|
|
7eead7588d | ||
|
|
ae100280e3 | ||
|
|
5b951aac4f | ||
|
|
ff5cdadf4d | ||
|
|
1e669d08a0 | ||
|
|
c5ae8d2980 | ||
|
|
ec8f49b0d7 | ||
|
|
a1b0a5ec97 | ||
|
|
487c80b475 | ||
|
|
cec926a090 | ||
|
|
23623f9cee | ||
|
|
f92aa3426c | ||
|
|
989617366a | ||
|
|
96324d4595 | ||
|
|
17ba947380 | ||
|
|
bab0aa8ebc | ||
|
|
b44226bea7 | ||
|
|
d56ebd1ff9 | ||
|
|
e034d1bf03 | ||
|
|
e99ae35661 | ||
|
|
d283de66b5 | ||
|
|
4d690d6ca8 | ||
|
|
604ab88b09 | ||
|
|
cad306b6de | ||
|
|
6363f7c386 | ||
|
|
c8abdc6343 | ||
|
|
9a12e9831b | ||
|
|
d470485c49 | ||
|
|
ad292fa496 | ||
|
|
0f4cb05418 | ||
|
|
3f3fb1e2ab | ||
|
|
fc44e72bb1 | ||
|
|
de915f748f | ||
|
|
968f1f213d | ||
|
|
19eb70e425 | ||
|
|
e5544644a7 | ||
|
|
8781c23939 | ||
|
|
8e89cae659 | ||
|
|
a22f80c053 | ||
|
|
9a1d042fb8 | ||
|
|
f7dbf97c53 | ||
|
|
eb34d25272 | ||
|
|
d6a8313a19 | ||
|
|
1020f7a498 | ||
|
|
4232475053 | ||
|
|
42d4126a5d | ||
|
|
aa9f71cfd7 | ||
|
|
18bccb8e5b | ||
|
|
e3576c31a3 | ||
|
|
53f06c0382 | ||
|
|
cfad0498b8 | ||
|
|
24e3ad5ed5 | ||
|
|
7a2abbc325 | ||
|
|
30adc49bc0 | ||
|
|
c9cbafcf40 | ||
|
|
80d5fed085 | ||
|
|
d3a1a4bf1b | ||
|
|
b7560ca07b | ||
|
|
0f814c8e16 | ||
|
|
e864ea1999 | ||
|
|
89d47bf147 | ||
|
|
9929836cc4 | ||
|
|
0b31ebdee6 | ||
|
|
ff25031d1e | ||
|
|
4a540cfd7b | ||
|
|
bf39bfe921 | ||
|
|
b95a8f985e | ||
|
|
144c3f2ed7 | ||
|
|
bc5a017695 | ||
|
|
0cff45f88c | ||
|
|
b54f6904d4 | ||
|
|
7a2e7850ad | ||
|
|
4d0bc6caa9 | ||
|
|
13bb6b516a | ||
|
|
872d5fc7f7 | ||
|
|
13e19d0c16 | ||
|
|
1d334f5e27 | ||
|
|
a8e998993c | ||
|
|
dfaa9b0a00 | ||
|
|
9b34e85cea | ||
|
|
22f8b2b12f | ||
|
|
cdea76dd14 | ||
|
|
88bee2da43 | ||
|
|
e5b27d290b | ||
|
|
3cc847e532 | ||
|
|
b97a2bbb6d | ||
|
|
b390774d1b | ||
|
|
112e2783f8 | ||
|
|
d69961746d | ||
|
|
494cb645bd | ||
|
|
2b1c527171 | ||
|
|
695b1ad660 | ||
|
|
97d244cb4c | ||
|
|
a91978941d | ||
|
|
6564a2cebd | ||
|
|
2d1fe16358 | ||
|
|
56e1d5577c | ||
|
|
67a4a6d85d | ||
|
|
a8bc660efa | ||
|
|
74d6b88fb0 | ||
|
|
7b464f2f2e | ||
|
|
e43ceb07cc | ||
|
|
5f23e1bbd6 | ||
|
|
b6e53777bd | ||
|
|
271c7e191f | ||
|
|
ef2589b73b | ||
|
|
a45ca53c2e | ||
|
|
6b57c75bd6 | ||
|
|
014ef652ff | ||
|
|
eeefd39035 | ||
|
|
a76e2daa0a | ||
|
|
c33bbd30c6 | ||
|
|
1e7bbed24b | ||
|
|
37629fa69b | ||
|
|
51759fa6dd | ||
|
|
deaa0f8911 | ||
|
|
922b042914 | ||
|
|
12c1295761 | ||
|
|
7326de54c6 | ||
|
|
9a6a03cf79 | ||
|
|
cdea9b37a3 | ||
|
|
6e50e5adcb | ||
|
|
ebb5aecc82 | ||
|
|
b4c825b9c9 | ||
|
|
e53d10d736 | ||
|
|
2701df7a9b | ||
|
|
f07959e06b | ||
|
|
9e710f3ec7 | ||
|
|
28777174bc | ||
|
|
8fd614e8ca | ||
|
|
2978da8b46 | ||
|
|
dfdb01424a | ||
|
|
632e58de8f | ||
|
|
752e52f75e | ||
|
|
ec6349230b | ||
|
|
bb4512614b | ||
|
|
59140395e9 | ||
|
|
d051250a57 | ||
|
|
a3687cbd21 | ||
|
|
468fcd881c | ||
|
|
34f7ddd3bd | ||
|
|
dea7426857 | ||
|
|
fb117c4a65 | ||
|
|
8ca633171a | ||
|
|
c43008fed5 | ||
|
|
4a03666e82 | ||
|
|
6d92b42636 | ||
|
|
0d98280272 | ||
|
|
9fa9190813 | ||
|
|
2557f971fe | ||
|
|
fa3b31a7ac | ||
|
|
4454ed520f | ||
|
|
3fabfcda1c | ||
|
|
6e0debe014 | ||
|
|
739c336a78 | ||
|
|
96b06ca89f | ||
|
|
002b207fcc | ||
|
|
6034fc7ac9 | ||
|
|
d45645bb7c | ||
|
|
c0bed628d2 | ||
|
|
742ce81bce | ||
|
|
9596adc9c3 | ||
|
|
28a7f96f78 | ||
|
|
89de8dcc62 | ||
|
|
1115b0e345 | ||
|
|
ed557f5677 | ||
|
|
8573e748c2 | ||
|
|
76df1ffb28 | ||
|
|
ac922ca980 | ||
|
|
4922e18a1a | ||
|
|
d3c89e293b | ||
|
|
66fd0746ba | ||
|
|
2e45b25cc6 | ||
|
|
390cfdc1c5 | ||
|
|
3bfa9a1c09 | ||
|
|
97e63a7b2a | ||
|
|
881b80ad1e | ||
|
|
dd09f19d8a | ||
|
|
1829a288be | ||
|
|
aeddfc5816 | ||
|
|
d1c52c07f1 | ||
|
|
5a27a68d29 | ||
|
|
2c629c7fcc | ||
|
|
f34408cf11 | ||
|
|
e3ccd48c17 | ||
|
|
9827c4231a | ||
|
|
9765d48bda | ||
|
|
b459545aa2 | ||
|
|
63cf13150a | ||
|
|
e7dddc4b65 | ||
|
|
2214b1ea40 | ||
|
|
92bab445f4 | ||
|
|
8cc5ef5b76 | ||
|
|
e034267666 | ||
|
|
71bb830f46 | ||
|
|
0504431389 | ||
|
|
9709ce3486 | ||
|
|
db87a8f904 | ||
|
|
559c025832 | ||
|
|
f0af41bfb3 | ||
|
|
28560aca23 | ||
|
|
08a62b466a | ||
|
|
f1ef4fa4c0 | ||
|
|
93cc403567 | ||
|
|
800cd164e8 | ||
|
|
0c1deb4c22 | ||
|
|
d81bf0e28d | ||
|
|
8344157840 | ||
|
|
a114840c3c | ||
|
|
d360d3a150 | ||
|
|
17fa8e7c04 | ||
|
|
6c0d32b401 | ||
|
|
1a6f05a107 | ||
|
|
7002ed6471 | ||
|
|
6d20a2817b | ||
|
|
6137cd17c7 | ||
|
|
ceb8afca9f | ||
|
|
36c68e9567 | ||
|
|
d1515168a5 | ||
|
|
2f32ea859f | ||
|
|
402bc37847 | ||
|
|
34b2dcfec6 | ||
|
|
4d89648fe5 | ||
|
|
55199bce21 | ||
|
|
9a1ebdbca7 | ||
|
|
e6fdecb6e3 | ||
|
|
a32aef964a | ||
|
|
5abb0fca0f | ||
|
|
ef6ee413b9 | ||
|
|
a9be6dc995 | ||
|
|
bfc5bb9a6b | ||
|
|
46241ebccc | ||
|
|
38975b4531 | ||
|
|
80ef8f064f | ||
|
|
5de95c83d8 | ||
|
|
2a944d31b9 | ||
|
|
7e2cdc3f55 | ||
|
|
380fbec59e | ||
|
|
f153e9e781 | ||
|
|
55f63bc616 | ||
|
|
28ce6706ca | ||
|
|
12ba6a089f | ||
|
|
ea65987f4e | ||
|
|
c5f56cc94f | ||
|
|
0c74815c91 | ||
|
|
6cfb78a8e0 | ||
|
|
d5ba6cb44b | ||
|
|
7d954d324c | ||
|
|
3989f56ea0 | ||
|
|
5de6a1b1f6 | ||
|
|
63ba41c31e | ||
|
|
4bc105c068 | ||
|
|
21f20d0115 | ||
|
|
e0f818a8f7 | ||
|
|
e96950a5fc | ||
|
|
635287d3e1 | ||
|
|
a0cbdc8ca3 | ||
|
|
af0004de87 | ||
|
|
d7d754775f | ||
|
|
ad2246d440 | ||
|
|
44d2c5c6f7 | ||
|
|
76a97eaa32 | ||
|
|
33190350e1 | ||
|
|
1212ad3ac9 | ||
|
|
29e7f4bb70 | ||
|
|
3b196a5253 | ||
|
|
109b7f1ad7 | ||
|
|
1059921827 | ||
|
|
02a4df3729 | ||
|
|
1920d511f1 | ||
|
|
54beab98db | ||
|
|
e811845fd7 | ||
|
|
fa6e945e67 | ||
|
|
3ae05a4518 | ||
|
|
aa623c94ad | ||
|
|
8168a0ed56 | ||
|
|
32a5287a98 | ||
|
|
8e6409e7f2 | ||
|
|
32286dc736 | ||
|
|
59b945ea4c | ||
|
|
fb4755d10f | ||
|
|
a0ec3a2b2c | ||
|
|
f9fb3b86aa | ||
|
|
05bb8acb6c | ||
|
|
0cb937d6b3 | ||
|
|
08c392a4c1 | ||
|
|
0eb06cebd6 | ||
|
|
b486e9a091 | ||
|
|
2ee166c9b7 | ||
|
|
3906d74396 | ||
|
|
67a6603c4c | ||
|
|
54c8eb676b | ||
|
|
6df0f8a03d | ||
|
|
78640ff72f | ||
|
|
b8e662c7d2 | ||
|
|
7954e39ad9 | ||
|
|
ea5caa0ea3 | ||
|
|
0e215b619b | ||
|
|
fb0320a395 | ||
|
|
236fafa8b2 | ||
|
|
f0d95aeabe | ||
|
|
d9848f6b13 | ||
|
|
8b6455b92f | ||
|
|
61e4c631be | ||
|
|
9c66c2c0f4 | ||
|
|
6a51980b4c | ||
|
|
5d38bb56ad | ||
|
|
ab6ed11e56 | ||
|
|
cd8837cef3 | ||
|
|
169ea13eba | ||
|
|
68a96a7118 | ||
|
|
737cc611c6 | ||
|
|
bffb34a7d8 | ||
|
|
874b4ca57a | ||
|
|
b0db738663 | ||
|
|
b9d40becde | ||
|
|
e01f58d7ee | ||
|
|
43b75264f5 | ||
|
|
f17ee4f211 | ||
|
|
9b85932c0e | ||
|
|
acdd152437 | ||
|
|
ecd6701de0 | ||
|
|
f5edc8bf69 | ||
|
|
4bc88b8502 | ||
|
|
3eb3836f94 | ||
|
|
d61ecd533d | ||
|
|
9e27bcb1de | ||
|
|
045c17b5e2 | ||
|
|
b7f1931ce3 | ||
|
|
1a288a3461 | ||
|
|
82cffd10ab | ||
|
|
42f9042c0c | ||
|
|
4ce02a273a | ||
|
|
71a3244ff6 | ||
|
|
8d2ac9ab47 | ||
|
|
2a6e5c639f | ||
|
|
6f82d23d5c | ||
|
|
8829e2cf74 | ||
|
|
454be62345 | ||
|
|
ea99a38f65 | ||
|
|
fecca49bfd | ||
|
|
dcaf8dffba | ||
|
|
7c1a16f9e1 | ||
|
|
16fbcb820c | ||
|
|
297129490a | ||
|
|
8ea872b5de | ||
|
|
0cce7fbe50 | ||
|
|
dec80408b0 | ||
|
|
39a10b79c1 | ||
|
|
8550919a11 | ||
|
|
011b335bc7 | ||
|
|
00f4cab3c2 | ||
|
|
de9636e78b | ||
|
|
c0f70009ab | ||
|
|
343f70f899 | ||
|
|
7c46f29e53 | ||
|
|
ecabd0ef99 | ||
|
|
dee0487534 | ||
|
|
d866675bde | ||
|
|
027cb325b4 | ||
|
|
fff446709a | ||
|
|
1e98aa8bf4 | ||
|
|
5e7853eb35 | ||
|
|
d1a443526c | ||
|
|
457c317139 | ||
|
|
28d5e29388 | ||
|
|
0c97a21a45 | ||
|
|
2cc070a4e1 | ||
|
|
e699035f62 | ||
|
|
7fba0a27fa | ||
|
|
9cbd325a71 | ||
|
|
cd7450e6f6 | ||
|
|
be4d2dcbb4 | ||
|
|
724b84f19e | ||
|
|
73b684d231 | ||
|
|
45427b66e6 | ||
|
|
809ab326c0 | ||
|
|
81442491e3 | ||
|
|
84feaa08ac | ||
|
|
27e33704f1 | ||
|
|
66cf5dad0b | ||
|
|
ff206fa18f | ||
|
|
8781b20696 | ||
|
|
6e64544c25 | ||
|
|
a1a3d62813 | ||
|
|
769835484e | ||
|
|
a0a554d76e | ||
|
|
79445660ba | ||
|
|
9fee78dcc2 | ||
|
|
2f0db01266 | ||
|
|
96b475a6ac | ||
|
|
b29acff5f9 | ||
|
|
029aa42073 | ||
|
|
a604cd5fff | ||
|
|
72788fc7df | ||
|
|
9c16ff387d | ||
|
|
5421bf328c | ||
|
|
030d646673 | ||
|
|
05221396cf | ||
|
|
b47678f14b | ||
|
|
14d9f45dff | ||
|
|
c1a0e57aed | ||
|
|
2a78942c0b | ||
|
|
a1c6a7a183 | ||
|
|
b7d127e479 | ||
|
|
f5c2acd391 | ||
|
|
eb07995085 | ||
|
|
42f0feee7b | ||
|
|
8199bdeb42 | ||
|
|
5fcb1bd7c4 | ||
|
|
cce3c0b331 | ||
|
|
c7ee993741 | ||
|
|
69d4d558c0 | ||
|
|
54f31695ab | ||
|
|
c79a0c9d9f | ||
|
|
94d4adff7f | ||
|
|
b07263afa3 | ||
|
|
9659159206 | ||
|
|
15210b81ba | ||
|
|
80cb907702 | ||
|
|
3133912c8a | ||
|
|
685638724d | ||
|
|
34081c8b70 | ||
|
|
5325a02337 | ||
|
|
4d27652cb6 | ||
|
|
ee00aaa21b | ||
|
|
b42a48095d | ||
|
|
5d272a72b2 | ||
|
|
681e844dc7 | ||
|
|
9bccb030e9 | ||
|
|
95c07a7b25 | ||
|
|
cc1f174443 | ||
|
|
69eed61396 | ||
|
|
993c099624 | ||
|
|
b83bf040f6 | ||
|
|
3ce0991973 | ||
|
|
6197e3faec | ||
|
|
3820b51c34 | ||
|
|
31363daccd | ||
|
|
1cc419150a | ||
|
|
2a61702569 | ||
|
|
be0178a94e | ||
|
|
0050d3d8de | ||
|
|
2f9ef42357 | ||
|
|
74f879cb88 | ||
|
|
a146d168a1 | ||
|
|
fc199b5e95 | ||
|
|
f59aebab71 | ||
|
|
8dfba85d39 | ||
|
|
fb1bff9c62 | ||
|
|
c446a21d35 | ||
|
|
24b80cad41 | ||
|
|
1e61af57f7 | ||
|
|
55974a0843 | ||
|
|
4d2477f2ca | ||
|
|
d9be6c0357 | ||
|
|
b87f961574 | ||
|
|
b6081c5891 | ||
|
|
a7fb48912b | ||
|
|
e7896a08dd | ||
|
|
9f058e838b | ||
|
|
aacdefe1dc | ||
|
|
654d8b07c2 | ||
|
|
934d7971cc | ||
|
|
551fd171b6 | ||
|
|
6da7d70492 | ||
|
|
c27a10a5f7 | ||
|
|
204ed315ae | ||
|
|
8b4c859c04 | ||
|
|
3e7d9ac9da | ||
|
|
2afd78c3eb | ||
|
|
900e167f89 | ||
|
|
451d572441 | ||
|
|
22157d2a4b | ||
|
|
d22b24e9bf | ||
|
|
66153991a7 | ||
|
|
c9c6ab6bb9 | ||
|
|
a4c155f3e1 | ||
|
|
cadb394ef8 | ||
|
|
5a3ed18bfe | ||
|
|
8c513594a2 | ||
|
|
47c681b4ab | ||
|
|
6eb3ece341 | ||
|
|
9077dcb6a3 | ||
|
|
3f1bd82dd5 | ||
|
|
8a8a838686 | ||
|
|
6fbf9090d6 | ||
|
|
2cf30cab35 | ||
|
|
a20572c35f | ||
|
|
b398e7e20c | ||
|
|
50d0a57060 | ||
|
|
8bddb0b68e | ||
|
|
40f4f1afcd | ||
|
|
50358b224a | ||
|
|
009af59774 | ||
|
|
bd6d8a02f4 | ||
|
|
022ef7df7a | ||
|
|
db0f5ac7ab | ||
|
|
f0f498a632 | ||
|
|
76c4d8654d | ||
|
|
d61708f8c2 | ||
|
|
4e28231cc2 | ||
|
|
89de7133d1 | ||
|
|
f6083977a5 | ||
|
|
29bbe61af8 | ||
|
|
e3fb6bc887 | ||
|
|
6f1f067710 | ||
|
|
9ced5cf29d | ||
|
|
c48eca9d64 | ||
|
|
aad9f7dd5b | ||
|
|
ab56f69f9e | ||
|
|
3fb1762bf6 | ||
|
|
ff4bbb989e | ||
|
|
c5538c4651 | ||
|
|
2ab0610e64 | ||
|
|
9a2bc2342c | ||
|
|
cd5eb59aab | ||
|
|
6e7caeb794 | ||
|
|
5e007283bd | ||
|
|
c04eea37f3 | ||
|
|
8b62b30606 | ||
|
|
c19df7fe10 | ||
|
|
e017793605 | ||
|
|
bf375e96f4 | ||
|
|
e109ffa4da | ||
|
|
c3d495d876 | ||
|
|
59b93f784f | ||
|
|
51fe6675a3 | ||
|
|
b5856645d8 | ||
|
|
dfdefa2175 | ||
|
|
608f3e9953 | ||
|
|
d2d302db52 | ||
|
|
38ab007d82 | ||
|
|
4d38d8077c | ||
|
|
16bb4cb5f7 | ||
|
|
6929d3ff40 | ||
|
|
2a8bdf122a | ||
|
|
f34ead7705 | ||
|
|
172c1da600 | ||
|
|
074f1bd1ef | ||
|
|
39bf2672b0 | ||
|
|
349b8e5bea | ||
|
|
be0f68f2ee | ||
|
|
de2d4ee25d | ||
|
|
99e29c06d4 | ||
|
|
43f12a8308 | ||
|
|
783bed6b98 | ||
|
|
1d71432a35 | ||
|
|
8332a9f33c | ||
|
|
608da40117 | ||
|
|
3fa77f8a70 | ||
|
|
e84e34480f | ||
|
|
e7e97d9656 | ||
|
|
205012a91f | ||
|
|
e6fd3b5033 | ||
|
|
8dac6402ff | ||
|
|
901548d9e7 | ||
|
|
ba2b6829a2 | ||
|
|
521edcc6bb | ||
|
|
4f4b5ccb7f | ||
|
|
4f7cf01786 | ||
|
|
4de58a958e | ||
|
|
97ec878b4c | ||
|
|
a897f156f0 | ||
|
|
3a5a95b32d | ||
|
|
aca7585531 | ||
|
|
6423c10a4b | ||
|
|
81aeb44742 | ||
|
|
5415835d76 | ||
|
|
ab036cc13e | ||
|
|
b5b0feb542 | ||
|
|
9ae2e1278d | ||
|
|
fd55006f95 | ||
|
|
fae6b51955 | ||
|
|
5a0ac76494 | ||
|
|
897245766d | ||
|
|
aa435fef0d | ||
|
|
751eab865b | ||
|
|
8b06322427 | ||
|
|
13bb88e84e | ||
|
|
b6eef0830c | ||
|
|
cb0b033d16 | ||
|
|
4992e8c725 | ||
|
|
0cd9398b83 | ||
|
|
6e8e09db42 | ||
|
|
e6b9550a3a | ||
|
|
cfa8111533 | ||
|
|
767855b15f | ||
|
|
4f456456e8 | ||
|
|
2a1677c6ee | ||
|
|
2ada4e2333 | ||
|
|
9e47ddcc5a | ||
|
|
1ecfa48022 | ||
|
|
bd3b812797 | ||
|
|
6577fcff11 | ||
|
|
b86ee5dd07 | ||
|
|
e2d13ef10b | ||
|
|
c3c383a9cb | ||
|
|
35ea5b463a | ||
|
|
c884270dd2 | ||
|
|
d825efdb0b | ||
|
|
49282078d0 | ||
|
|
e5e54acb41 | ||
|
|
54573e8c14 | ||
|
|
ab0b464dac | ||
|
|
6411fd735c | ||
|
|
67b95d8c73 | ||
|
|
bee9924a29 | ||
|
|
235ea7d982 | ||
|
|
bec920f07f | ||
|
|
d0e0e61c85 | ||
|
|
786050926c | ||
|
|
88a75d0629 | ||
|
|
1464355c71 | ||
|
|
a8635c059d | ||
|
|
2490e95516 | ||
|
|
74b793ee74 | ||
|
|
8b69cecd4a | ||
|
|
85477cf6bc | ||
|
|
fc69de5d66 | ||
|
|
53720a5b23 | ||
|
|
784de2139f | ||
|
|
fd884ca728 | ||
|
|
52d4b6f7b0 | ||
|
|
e9c0c24829 | ||
|
|
fba995f794 | ||
|
|
13d2fd0c5b | ||
|
|
d62304a988 | ||
|
|
8d51bc9133 | ||
|
|
1265a76d72 | ||
|
|
84b1548106 | ||
|
|
19f65cc8fb | ||
|
|
b9b048a4c3 | ||
|
|
dfba96224d | ||
|
|
728b04aa53 | ||
|
|
157c0c3e4e | ||
|
|
3fc552312a | ||
|
|
29359ea87f | ||
|
|
7620e1cf22 | ||
|
|
cebe039944 | ||
|
|
6eecb0f697 | ||
|
|
83e191b44c | ||
|
|
e6667ebd81 | ||
|
|
92d33c6c4c | ||
|
|
35fb7ae3ff | ||
|
|
bb233dbd91 | ||
|
|
a4239a518c | ||
|
|
1d71716bb2 | ||
|
|
3b3ae1d5c3 | ||
|
|
1f46765b00 | ||
|
|
41e10ddf7c | ||
|
|
535fa8243a | ||
|
|
08727254f6 | ||
|
|
c35347f0a5 | ||
|
|
a514c716cf | ||
|
|
21b6f4c05f | ||
|
|
b617c69fd3 | ||
|
|
642627648d | ||
|
|
1627fffa8b | ||
|
|
1b3a4207fa | ||
|
|
286220d07a | ||
|
|
3566a30074 | ||
|
|
1bd98c9c38 | ||
|
|
da16c21ab5 | ||
|
|
c048408aba | ||
|
|
9baef907d2 | ||
|
|
d743be5ba6 | ||
|
|
c74553085e | ||
|
|
0cafd02010 | ||
|
|
1e94463a06 | ||
|
|
96f096c764 | ||
|
|
931e86c7b5 | ||
|
|
0b92da973a | ||
|
|
2efc5d4218 | ||
|
|
b861cc8986 | ||
|
|
bcda9c21d5 | ||
|
|
3e4208ffc2 | ||
|
|
7ad9cd61bf | ||
|
|
fac2a3b0b2 | ||
|
|
627307e8a5 | ||
|
|
75cdb0fb7f | ||
|
|
7522bd8c42 | ||
|
|
35ae99199e | ||
|
|
282e5df505 | ||
|
|
df119a577a | ||
|
|
8b0664423b | ||
|
|
fbe76c37f6 | ||
|
|
63c42435db | ||
|
|
2408a07190 | ||
|
|
2af3c78c71 | ||
|
|
48f42e4a25 | ||
|
|
af1c0768ac | ||
|
|
ed5f19a88a | ||
|
|
3441ecf6d3 | ||
|
|
3c335bf66f | ||
|
|
cad652e031 | ||
|
|
f956e0c17d | ||
|
|
af9934e308 | ||
|
|
36574af264 | ||
|
|
a39db6c102 | ||
|
|
5de4e3a511 | ||
|
|
12f12f0e61 | ||
|
|
63f708fb72 | ||
|
|
dc776b673a | ||
|
|
e11c893475 | ||
|
|
79ce221302 | ||
|
|
40470fabd9 | ||
|
|
d726dedc67 | ||
|
|
dfb222c581 | ||
|
|
b26d488be9 | ||
|
|
aacc0667f9 | ||
|
|
8e606cf6b1 | ||
|
|
8c538ad6af | ||
|
|
97123b05cc | ||
|
|
77c0fabb74 | ||
|
|
a554f17cbf | ||
|
|
79adad4cf2 | ||
|
|
5488697d3e | ||
|
|
906d9970d8 | ||
|
|
40456e7961 | ||
|
|
52356e6b35 | ||
|
|
3d7f48b26d | ||
|
|
6fa3b3f4ba | ||
|
|
77f9d237e4 | ||
|
|
117003345d | ||
|
|
bfa97587b9 | ||
|
|
a121036a77 | ||
|
|
50e15c94f5 | ||
|
|
92770c720b | ||
|
|
e372b2de97 | ||
|
|
97dc486b7b | ||
|
|
9cb286be10 | ||
|
|
55fbb182a0 | ||
|
|
4e6eae79e4 | ||
|
|
9f5a8c1640 | ||
|
|
fc3ad7e30b | ||
|
|
8eab440bf2 | ||
|
|
1771a3227a | ||
|
|
3aa128d934 | ||
|
|
d8d6b1ffbf | ||
|
|
92270e91ec | ||
|
|
62420fd91a | ||
|
|
b0ad9bc94d | ||
|
|
3f48fe6a99 | ||
|
|
36f7326596 | ||
|
|
1363079150 | ||
|
|
aa720896b4 | ||
|
|
f9e1b5683b | ||
|
|
1d6c60a79a | ||
|
|
50102b318e | ||
|
|
248ee6e2a6 | ||
|
|
765391b9f4 | ||
|
|
4d9f0342b5 | ||
|
|
c7fe445508 | ||
|
|
493b2d6906 | ||
|
|
22ce7d4099 | ||
|
|
2d3ec9d137 | ||
|
|
ba23299cdc | ||
|
|
e39e43d8a9 | ||
|
|
8f76160d7c | ||
|
|
35af4fe25c | ||
|
|
4c1b8d00a9 | ||
|
|
590098cc08 | ||
|
|
4a703e04c9 | ||
|
|
2122f16622 | ||
|
|
c230ccf09d | ||
|
|
047560a351 | ||
|
|
128addb910 | ||
|
|
d47da6c11a | ||
|
|
2a3cc4d8db | ||
|
|
3861b0a2df | ||
|
|
975e99fd35 | ||
|
|
26b534a9f1 | ||
|
|
872600c14e | ||
|
|
d0a2ca8d65 | ||
|
|
e9963e5b69 | ||
|
|
4aef61a74d | ||
|
|
3f8fe577f6 | ||
|
|
e80835ba1f | ||
|
|
3cea7de87f | ||
|
|
820dbdddf4 | ||
|
|
1b0cb23c93 | ||
|
|
f7fcfcc31f | ||
|
|
abbe406cac | ||
|
|
a029a5fbb3 | ||
|
|
e28b984c9a | ||
|
|
786aa46e04 | ||
|
|
7e7053dea6 | ||
|
|
580a96ca60 | ||
|
|
56ef8c1604 | ||
|
|
d889d4241b | ||
|
|
a14acdaf59 | ||
|
|
db321da222 | ||
|
|
eee3de641e | ||
|
|
1d81d90e01 | ||
|
|
6eb9f6753f | ||
|
|
49c399806e | ||
|
|
5f2e72cd12 | ||
|
|
75dd3fb8e3 | ||
|
|
812a8e3558 | ||
|
|
0fb43b9363 | ||
|
|
c19d9fa182 | ||
|
|
29d4bd7cd8 | ||
|
|
a2f52ba688 | ||
|
|
39bd74c201 | ||
|
|
acea7c3f07 | ||
|
|
4a78bc9acc | ||
|
|
edbfa15f91 | ||
|
|
1fdef5eb0f | ||
|
|
cc8aee4fb4 | ||
|
|
a29934e8c1 | ||
|
|
b780cb234b | ||
|
|
7cdee5a619 | ||
|
|
515688be68 | ||
|
|
928fafe636 | ||
|
|
54212085d9 | ||
|
|
ca49540cb2 | ||
|
|
90e3796c9a | ||
|
|
02165991fe | ||
|
|
378b563dad | ||
|
|
11d37767c5 | ||
|
|
9af37e9401 | ||
|
|
891915ec82 | ||
|
|
ce61acacc1 | ||
|
|
a0bfee3f9e | ||
|
|
3658709051 | ||
|
|
e0c10b0fe5 | ||
|
|
798f587c4f | ||
|
|
8ad766b8a6 | ||
|
|
bcedb72249 | ||
|
|
0238c0234e | ||
|
|
1f983e495c | ||
|
|
9124d2f1e2 | ||
|
|
ef70d2aa24 | ||
|
|
4ed73e110b | ||
|
|
fe479d09fb | ||
|
|
b7ea5564cb | ||
|
|
2cc5ef39f8 | ||
|
|
e6441f7bf8 | ||
|
|
c4e0c492f1 | ||
|
|
c3c5aafac6 | ||
|
|
6524ea60ad | ||
|
|
628660c086 | ||
|
|
6ba7859027 | ||
|
|
bc61ca8672 | ||
|
|
62b8fda959 | ||
|
|
ee65991e8d | ||
|
|
0d6cccf8f0 | ||
|
|
096068ccc3 | ||
|
|
708b60e50e | ||
|
|
afca94762e | ||
|
|
b9be74eaf2 | ||
|
|
5a3209dcc7 | ||
|
|
f3f8041166 | ||
|
|
80ee334925 | ||
|
|
9cbc121992 | ||
|
|
eba451cf3a | ||
|
|
c585108118 | ||
|
|
afb59dc6c2 | ||
|
|
fcd73beae4 | ||
|
|
169515a8c4 | ||
|
|
1fd0097963 | ||
|
|
ba51e3f653 | ||
|
|
ed594216cc | ||
|
|
78b16a0743 | ||
|
|
dc91892634 | ||
|
|
357c1212c1 | ||
|
|
1113611f2e | ||
|
|
31f7121901 | ||
|
|
c3d09a7095 | ||
|
|
97b90cb7cc | ||
|
|
9f4e80edd5 | ||
|
|
2974bf900b | ||
|
|
80b2a660cd | ||
|
|
01d4323f02 | ||
|
|
957f907387 | ||
|
|
e727a17ed9 | ||
|
|
380b952606 | ||
|
|
8c9b422b69 | ||
|
|
bcd269b931 | ||
|
|
f4dd17fd4b | ||
|
|
c72810d69a | ||
|
|
983a5d36a1 | ||
|
|
72036d1f43 | ||
|
|
4b58718da0 | ||
|
|
01a0cf6686 | ||
|
|
183681a4d1 | ||
|
|
d64446fe7d | ||
|
|
c9d34d5736 | ||
|
|
69ef11cae2 | ||
|
|
ad5c395e30 | ||
|
|
840bafb136 | ||
|
|
1613eca16b | ||
|
|
4587132a3e | ||
|
|
583a69195b | ||
|
|
013669d2dc | ||
|
|
64e9346c8f | ||
|
|
be91726560 | ||
|
|
a021e2d7fb | ||
|
|
dcb42e6c42 | ||
|
|
0139692edb | ||
|
|
8671c8f504 | ||
|
|
36d5a5b3db | ||
|
|
20a81da5cd | ||
|
|
7eb6773fbd | ||
|
|
209799ea95 | ||
|
|
5a0fc235a0 | ||
|
|
654cd5f7dc | ||
|
|
67f8a689af | ||
|
|
a365bcf978 | ||
|
|
9efe5e82e7 | ||
|
|
d1cb7bb7aa | ||
|
|
7884078f87 | ||
|
|
4c78b0d33a | ||
|
|
df2eb70601 | ||
|
|
e597daf289 | ||
|
|
a574c1bf74 | ||
|
|
9105033cad | ||
|
|
b78fe80e6f | ||
|
|
9c8ecdd814 | ||
|
|
477e3a0a30 | ||
|
|
6750b2880f | ||
|
|
0f17151cd1 | ||
|
|
074915b8cb | ||
|
|
b43a39084c | ||
|
|
33d50107ac | ||
|
|
56146fa77c | ||
|
|
2b8287fa3e | ||
|
|
17f390ed9c | ||
|
|
2cda92a291 | ||
|
|
2db3fbab65 | ||
|
|
bb36311dee | ||
|
|
ec34f2e310 | ||
|
|
63560a25d4 | ||
|
|
c36dbd80a4 | ||
|
|
2083e0ef92 | ||
|
|
a7c2dc19e7 | ||
|
|
0a46f47d53 | ||
|
|
8b81a019b2 | ||
|
|
f96c77b4dd | ||
|
|
fceed3f9e6 | ||
|
|
d12cc4c83e | ||
|
|
d846f0cb25 | ||
|
|
f0291a164c | ||
|
|
78e5eb7d1d | ||
|
|
b7d31f060d | ||
|
|
26a69191a0 | ||
|
|
c67efd002c | ||
|
|
58251a3bd5 | ||
|
|
6d063e6f7f | ||
|
|
3aaf4a9970 | ||
|
|
fedf3b3209 | ||
|
|
b0753af034 | ||
|
|
ab4a5e13fa | ||
|
|
f43d31877f | ||
|
|
cf061f2622 | ||
|
|
cd6e031a34 | ||
|
|
542a206d01 | ||
|
|
f97448429e | ||
|
|
95077c712b | ||
|
|
7aa6104e14 | ||
|
|
60902de817 | ||
|
|
1c851e1817 | ||
|
|
161d1cb6c9 | ||
|
|
3b90e3e6a2 | ||
|
|
86497ea2c8 | ||
|
|
2b8ed46a59 | ||
|
|
4aef1245c9 | ||
|
|
e37cb11343 | ||
|
|
26047e92a5 | ||
|
|
22586db454 | ||
|
|
3e224391fe | ||
|
|
beb6f9a114 | ||
|
|
2a84d8d728 | ||
|
|
bed9898498 | ||
|
|
4aa9a89ed5 | ||
|
|
181257ab9e | ||
|
|
680432877d | ||
|
|
4080d95306 | ||
|
|
d92a78c563 | ||
|
|
64618001f4 | ||
|
|
e8089a9f7d | ||
|
|
6821d6dca4 | ||
|
|
f266b18285 | ||
|
|
b1e966b6b6 | ||
|
|
e3d8e6fe3f | ||
|
|
4fa2a65db2 | ||
|
|
582a4ab7e4 | ||
|
|
f0c17ae27a | ||
|
|
db74213976 | ||
|
|
f55cca4827 | ||
|
|
0b53e96a71 | ||
|
|
f477ba4cf8 | ||
|
|
a24a187fe0 | ||
|
|
3da1929c70 | ||
|
|
f5e154d24a | ||
|
|
54bde33675 | ||
|
|
a771c37ca6 | ||
|
|
60c3b5fecb | ||
|
|
6d32f8ed06 | ||
|
|
40c53d073b | ||
|
|
31324ba240 | ||
|
|
c27e34da2c | ||
|
|
75a2aba102 | ||
|
|
cdcf75f60f | ||
|
|
8f0146812b | ||
|
|
e3e709f69b | ||
|
|
0db39e04dc | ||
|
|
eb77f8cbdd | ||
|
|
a471490e6e | ||
|
|
99e04027a6 | ||
|
|
52b6ab1aac | ||
|
|
f623438072 | ||
|
|
57e906c403 | ||
|
|
3e46942841 | ||
|
|
ee5d7640d2 | ||
|
|
d8d367986e | ||
|
|
343c80486e | ||
|
|
a8a486eb58 | ||
|
|
1cb131bff3 | ||
|
|
b0b2a5f1f8 | ||
|
|
bee7d84536 | ||
|
|
cb34e6dfef | ||
|
|
de00f0739d | ||
|
|
d9385ef82e | ||
|
|
692bc3eb3c | ||
|
|
1393e4dcef | ||
|
|
a3020a5136 | ||
|
|
baaf637a41 | ||
|
|
07c3339975 | ||
|
|
29e9970d68 | ||
|
|
abee17325d | ||
|
|
5cfb2f2a43 | ||
|
|
56471fb574 | ||
|
|
f259758f42 | ||
|
|
c0e3ac8c60 | ||
|
|
6ddb4c98d6 | ||
|
|
fb67cd2b86 | ||
|
|
04251cd9f9 | ||
|
|
d5ae2e0617 | ||
|
|
f6fecd4df2 | ||
|
|
38c12ec313 | ||
|
|
26813c7178 | ||
|
|
0ff2a6d5d0 | ||
|
|
401f0a5a42 | ||
|
|
4334283cc6 | ||
|
|
1947269b11 | ||
|
|
6be391371d | ||
|
|
b69baae4b8 | ||
|
|
47c0e647cc | ||
|
|
aa09b47c3a | ||
|
|
5f69d430a3 | ||
|
|
d87a0e2ce3 | ||
|
|
4761671cac | ||
|
|
e23fd407e7 | ||
|
|
891d94a66a | ||
|
|
371216bbe6 | ||
|
|
66aa26788a | ||
|
|
0ebcb5ac2c | ||
|
|
13f7240b01 | ||
|
|
160f6b184e | ||
|
|
f724249202 | ||
|
|
078e555de3 | ||
|
|
eeba5e4a07 | ||
|
|
1c2785c056 | ||
|
|
d6136e6310 | ||
|
|
4d564e6f23 | ||
|
|
0837423de9 | ||
|
|
4fd661d042 | ||
|
|
1f65bda6d9 | ||
|
|
544d2b8b48 | ||
|
|
e4b53c6601 | ||
|
|
4e49d5ee14 | ||
|
|
8dcaeba4f6 | ||
|
|
7840590d2b | ||
|
|
d2b0cf37af | ||
|
|
cabe51b673 | ||
|
|
2a3e5e5d2c | ||
|
|
3affb5e1e5 | ||
|
|
8cfc12b3c0 | ||
|
|
1ef438214e | ||
|
|
8832f929dd | ||
|
|
a436f10782 | ||
|
|
eb7ec6aacf | ||
|
|
bf0af8658b | ||
|
|
e4dd711bc4 | ||
|
|
0c01347964 | ||
|
|
747b4024f0 | ||
|
|
ada5312e5e | ||
|
|
b5a07ddad0 | ||
|
|
83902fc977 | ||
|
|
99d7bdeb15 | ||
|
|
4897d42e4a | ||
|
|
8dc42c3d36 | ||
|
|
a4b20a3b5d | ||
|
|
0a3637e806 | ||
|
|
7cdf4938fb | ||
|
|
9f684e3198 | ||
|
|
13545cfd3a | ||
|
|
6dc29b1ab0 | ||
|
|
4ba02efdb3 | ||
|
|
7d523af813 | ||
|
|
09fb50d444 | ||
|
|
b934dcd9ac | ||
|
|
e39b9b853f | ||
|
|
54b5529670 |
33
.gitignore
vendored
Normal file
33
.gitignore
vendored
Normal file
@@ -0,0 +1,33 @@
|
|||||||
|
*.user
|
||||||
|
.qmake.stash
|
||||||
|
.qtc_clangd/**
|
||||||
|
Makefile
|
||||||
|
bin/**
|
||||||
|
build/**
|
||||||
|
build_dir/**
|
||||||
|
helper/*.o
|
||||||
|
helper/.qtc_clangd/**
|
||||||
|
helper/moc*.*
|
||||||
|
helper/octphelper
|
||||||
|
cachecleaner/bin/**
|
||||||
|
cachecleaner/build/**
|
||||||
|
cachecleaner/.qtc_clangd/**
|
||||||
|
notifier/bin/**
|
||||||
|
notifier/build/**
|
||||||
|
notifier/.qtc_clangd/**
|
||||||
|
notifier/.qtc/**
|
||||||
|
notifier/.cmake/**
|
||||||
|
notifier/CMakeCache*
|
||||||
|
notifier/CMakeFiles*
|
||||||
|
notifier/qtcsettings.cmake
|
||||||
|
octopi.pro.user
|
||||||
|
qrc_resources.cpp
|
||||||
|
repoeditor/.qtc_clangd/**
|
||||||
|
repoeditor/bin/**
|
||||||
|
repoeditor/build/**
|
||||||
|
sudo/*.o
|
||||||
|
sudo/moc*.*
|
||||||
|
sudo/octopi-sudo
|
||||||
|
sudo/qrc*.cpp
|
||||||
|
sudo/ui_pass*.h
|
||||||
|
sudo/.qtc_clangd
|
||||||
11
.tx/config
Normal file
11
.tx/config
Normal file
@@ -0,0 +1,11 @@
|
|||||||
|
[main]
|
||||||
|
host = https://www.transifex.com
|
||||||
|
|
||||||
|
[o:arnt:p:octopi:r:octopi]
|
||||||
|
file_filter = resources/translations/octopi_<lang>.ts
|
||||||
|
source_file = resources/translations/octopi_en.ts
|
||||||
|
source_lang = en
|
||||||
|
type = QT
|
||||||
|
replace_edited_strings = false
|
||||||
|
keep_translations = false
|
||||||
|
|
||||||
684
CHANGELOG
684
CHANGELOG
@@ -1,4 +1,670 @@
|
|||||||
0.1.6
|
0.19 (dev)
|
||||||
|
BugFix: Pressing F11 to maximize bottom panel crashed Octopi if Info tab was selected.
|
||||||
|
BugFix: Octopi crashed after using AUR/KCP tool and clicking on a package anchor
|
||||||
|
in Output tab.
|
||||||
|
BugFix: Optional deps dialog had a column header named "3" instead of "Repository".
|
||||||
|
BugFix: Some outdated AUR pkgs were not showing on notifier (thanks to urbenlegend).
|
||||||
|
BugFix: There was a method called more than once every time distro news was checked.
|
||||||
|
Add the option to make the whole interface text less condensed.
|
||||||
|
Add the option to show/hide "Repository" and "Download Size" columns in package list.
|
||||||
|
Add Repository field in Info tab.
|
||||||
|
Make "Search for outdated AUR packages" a notifier only option.
|
||||||
|
Enable Check updates and System upgrade tool buttons in AUR mode.
|
||||||
|
Show current version of the packages on Notifier's System Upgrade dialog
|
||||||
|
(thanks to valchx's code).
|
||||||
|
Added chinese description for the application name in desktop file.
|
||||||
|
Updated translations.
|
||||||
|
|
||||||
|
0.18.1 (2025-09-29)
|
||||||
|
BugFix: French translation was not working properly (thanks to roxfr).
|
||||||
|
BugFix: Yay searches with version 12.5.2 crashed Octopi (thanks to nije-to-sve).
|
||||||
|
BugFix: Search for BASH also in "/bin".
|
||||||
|
BugFix: Force use of BASH shell was not working (thanks to UnsaltedScholar).
|
||||||
|
BugFix: List of outdated KCP packages was not working in KaOS.
|
||||||
|
BugFix: Under some conditions Octopi could crash due to shared memory access failures.
|
||||||
|
Updated translations.
|
||||||
|
|
||||||
|
0.18.0 (2025-09-20)
|
||||||
|
BugFix: The act of moving the mouse over the package list was triggering many
|
||||||
|
"pacman -Si" executions (thanks to RAZUMNO).
|
||||||
|
BugFix: Notifier did not fetch updates for the first time when using "once a day".
|
||||||
|
BugFix: qt-sudo now respects user locale settings (thanks to D10RUS).
|
||||||
|
BugFix: Use better way to detect if user is running the tools from the right place.
|
||||||
|
BugFix: Select Help tab when Octopi runs for the first time.
|
||||||
|
BugFix: Make Actions tab visible when a package is selected for insertion/removal.
|
||||||
|
BugFix: Use system theme folder icon in Files tab.
|
||||||
|
BugFix: Package list refresh was not running after a group install/removal.
|
||||||
|
BugFix: ILoveCandy option was not working 100% in parser.
|
||||||
|
Search option selected by the user is saved on close.
|
||||||
|
Added support for garuda-update command when running in Garuda Linux.
|
||||||
|
Added support for a user specified backup shell script that needs to be placed at
|
||||||
|
"/usr/lib/octopi/pre-system-upgrade.sh" and executes before the system upgrades.
|
||||||
|
Added support for pacman.conf's IgnorePkg option through "Add to Ignored" and
|
||||||
|
"Remove from Ignored" actions from the context menu in the package list.
|
||||||
|
Added View/Ignored menu option.
|
||||||
|
Added support for Plus and Minus keys to add and remove packages from the system.
|
||||||
|
Added "Get Latest distro news" menu item to the News tab context menu.
|
||||||
|
Added Apply and Cancel buttons also in the Actions tab.
|
||||||
|
Added "Enable package tooltips" option, so users can disable the feature when needed.
|
||||||
|
Added "Force use of BASH shell" option to ensure compatibility when the user
|
||||||
|
uses another SHELL.
|
||||||
|
Added Tools/pacman-key option to refresh pacman gpg keys.
|
||||||
|
Modernization of Options dialog.
|
||||||
|
Updated translations.
|
||||||
|
|
||||||
|
0.17.0 (2025-02-18)
|
||||||
|
BugFix: Code for EndeavourOS news was incomplete (thanks to LegitGreenBoi).
|
||||||
|
BugFix: Help msg for newer packages was wrong because they're not installed.
|
||||||
|
Prefer Bash shell (/usr/bin/bash) when executing package commands.
|
||||||
|
Added "--editmenu" checkbox on Options dialog if you are using Yay tool.
|
||||||
|
Added option to always use the terminal when executing pacman actions.
|
||||||
|
Play a bell sound when the Terminal tab is asking for the user password.
|
||||||
|
Improvement: Let user choose which domain is pinged when checking for internet access
|
||||||
|
(if ping.archlinux.org is down).
|
||||||
|
Improvement: Show a "Collecting transaction data..." msg before presenting the transaction
|
||||||
|
dialog, as it can be quite slow on some systems (thanks to Valdir).
|
||||||
|
Updated translations.
|
||||||
|
|
||||||
|
0.16.2 (2024-06-17)
|
||||||
|
BugFix: Increased width of Terminal tab labels on Options dialog.
|
||||||
|
BugFix: Removed a debug msg when octopi was not being executed with "-d".
|
||||||
|
Updated translations.
|
||||||
|
|
||||||
|
0.16.1 (2024-06-09)
|
||||||
|
BugFix: Updated some LANG environment variables to C.UTF-8.
|
||||||
|
BugFix: Info/Files tabs were always empty if they were selected at octopi's start.
|
||||||
|
BugFix: Do not install notifier's desktop file in /etc/xdg/autostart.
|
||||||
|
BugFix: Could not remove packages when internet connection was down (thanks to Theluga).
|
||||||
|
Added shortcut key "Ctrl+Shift+U" to upgrade outdated AUR packages.
|
||||||
|
Arrow keys navegation refresh Info and Files tabs again.
|
||||||
|
Updated translations.
|
||||||
|
|
||||||
|
0.16.0 (2024-05-19)
|
||||||
|
BugFix: '--noeditmenu' is deprecated. Use '--editmenu=false' instead (thanks to rbaruccojr).
|
||||||
|
BugFix: Fixed silent error when pacman's database is locked (thanks to SloppyPuppy).
|
||||||
|
BugFix: Files tab expand all items by default.
|
||||||
|
BugFix: Updated translations.
|
||||||
|
Now using the unified qt-sudo project (https://github.com/aarnt/qt-sudo) for privilege escalation.
|
||||||
|
Default to Qt6 lib build (including qtermwidget6)
|
||||||
|
|
||||||
|
0.15.0 (2023-09-10)
|
||||||
|
BugFix: Invalidate Info/Files tabs when user is navigating packages using the keyboard.
|
||||||
|
BugFix: Better handle dependencies while staging packages for deletion.
|
||||||
|
BugFix: First yay-bin download now works again.
|
||||||
|
BugFix: Polished navigation on Info tab dependencies
|
||||||
|
BugFix: AUR passwords that contained a "+" char failed to login at aur.archlinux.org.
|
||||||
|
BugFix: When using the pacman backend, call "pacman -Qm" to fetch ALL foreign packages.
|
||||||
|
BugFix: Change install reason did not work with pacman backend.
|
||||||
|
Made the code Qt5/Qt6 compatible.
|
||||||
|
Using "pacman -Fl" to view contents of non installed packages (thanks to Zesko).
|
||||||
|
Added a Terminal tab to options dialog to config its colors and fonts.
|
||||||
|
Octopi-sudo code was synced to match project "lxqt-sudo" version 1.3.0.
|
||||||
|
|
||||||
|
0.14.0 (2022-10-05)
|
||||||
|
Added --overwrite="*" checkbox in AUR tab (Tools/Options) when using yay.
|
||||||
|
Octopi-sudo code was synced to match project "lxqt-sudo" version 1.1.0.
|
||||||
|
BugFix: Package search did not work correctly when query string contained a "+" sign.
|
||||||
|
BugFix: Info/Files tab refresh was duplicated.
|
||||||
|
BugFix: Disable (another try) Info/Files tab refresh while typing in Filter/Search
|
||||||
|
line edit.
|
||||||
|
|
||||||
|
0.13.0 (2022-03-30)
|
||||||
|
BugFix: editFile() caused a crash while in Mate desktop. Both "Open PKGBUILD"
|
||||||
|
and "Show PKGBUILD diff" options were affected.
|
||||||
|
BugFix: removed stylesheet from treeviews. It makes dark themes look better
|
||||||
|
(thanks to buckmelanoma).
|
||||||
|
BugFix: Pressing ENTER over an installed AUR pkg no longer sends it to the
|
||||||
|
install action treeview.
|
||||||
|
BugFix: Made Octopi compatible with aurweb 6.x version (view PKGBUILD,
|
||||||
|
diff PKGBUILD, vote, unvote and list voted AUR).
|
||||||
|
Added "Outdated" filter/option on menu "View".
|
||||||
|
Added a "-checkupdates" parameter to Notifier, so users can update the status
|
||||||
|
of an already running Octopi Notifier.
|
||||||
|
Added option to update selected outdated AUR pkgs directly from the main list.
|
||||||
|
|
||||||
|
0.12.0 (2021-11-06)
|
||||||
|
Added support for pacman 6.0 (thanks to class101)
|
||||||
|
Added support for Paru AUR tool.
|
||||||
|
Added support for opendoas tool (default).
|
||||||
|
Added support for Archcraft OS.
|
||||||
|
Added support for Garuda Linux distro.
|
||||||
|
Added support for Obarun Linux distro.
|
||||||
|
Actions tab shows a counter feedback for inserts (with a plus signal) and
|
||||||
|
removals (with a minus signal) and does not steal focus anymore.
|
||||||
|
Octopi-sudo code was synced to match project "lxqt-sudo" version 1.0.0.
|
||||||
|
BugFix: Initial database searches are executed after main interface is shown.
|
||||||
|
This improves UI feedback on older cpus.
|
||||||
|
BugFix: If there was only 1 result in AUR search, the pkg could not enter
|
||||||
|
the transaction with the right name.
|
||||||
|
BugFix: IgnorePkg pkgs are shown as outdated when using ALPM backend.
|
||||||
|
BugFix: If user went from AUR to normal search with a not found pkg the statusbar
|
||||||
|
counters would become invisible.
|
||||||
|
BugFix: If options dialog was called while both notifier and octopi were running,
|
||||||
|
Updates tab was not shown.
|
||||||
|
|
||||||
|
0.11.0 (2021-01-11)
|
||||||
|
Added support for CMake build system (thanks to Tereius).
|
||||||
|
Added support to build multiple foreign packages at once (they are first copied
|
||||||
|
to the Actions' tree view just like official packages).
|
||||||
|
Added "Open PKGBUILD" option to open the AUR PKGBUILD file in a text editor.
|
||||||
|
Added "Show PKGBUILD diff" option to show the differences between latest and previous
|
||||||
|
PKGBUILD files of the selected AUR package in a text editor.
|
||||||
|
Added "Install Date" at Info tab.
|
||||||
|
Added "Licenses", "Maintainer", "Depends On", "Make Deps", "Last Modified" and "Out-of-date"
|
||||||
|
fields at Info tab while in AUR mode.
|
||||||
|
Added option to display "Licenses", "Installed Size", "Build Date", "Install Date" and
|
||||||
|
"Install Reason" columns in the package list.
|
||||||
|
Added option to "Change Install Reason" of selected packages (Explicitly <-> As Dependency).
|
||||||
|
Added a faster refresh package list code after checking for updates.
|
||||||
|
Added "Build directory" option in AUR tab on options dialog, so users can change where
|
||||||
|
makepkg builds the source code.
|
||||||
|
Added support for '^' and '$' chars in AUR search
|
||||||
|
Added "Open news in a browser" option on right clicking the News tab.
|
||||||
|
Optional package dependencies are now installed with "--asdeps" parameter.
|
||||||
|
Octopi-sudo code was synced to match project "lxqt-sudo" version 0.16.0.
|
||||||
|
Updated PKGBUILD file following MatMoul's suggestion.
|
||||||
|
Removed unused speedup service.
|
||||||
|
Prevent users from running Octopi, Notifier and Cache Cleaner outside "/usr/bin" dir.
|
||||||
|
BugFix: Disable Info/Files tab refresh while typing in filter/search line edit.
|
||||||
|
BugFix: unset TMPDIR environment variable on every Octo tool startup
|
||||||
|
(to avoid "octopi-helper[aborted]: Couldn't attach to memory" errors).
|
||||||
|
BugFix: "total download size" showed the value 0 in Notifier if the database was not synched.
|
||||||
|
BugFix: Pressing ESC in repoeditor could ask if you wanted to save your changes even
|
||||||
|
if there were no changes made.
|
||||||
|
BugFix: Running Notifier within a DE session could lead to a "Suspicious execution method" error.
|
||||||
|
BugFix: If you tried to execute octopi after upgrading your system with notifier you got a
|
||||||
|
notifier crash and an octopi freeze (thanks to linuxer for pointing that out).
|
||||||
|
BugFix: Prevent icon changes in notifier when there were transaction errors.
|
||||||
|
BugFix: The list of targets to install were not showing ok in the transaction dialog.
|
||||||
|
BugFix: Restored support for command line parameters like "-sysupgrade-noconfirm" and "-style".
|
||||||
|
BugFix: Updated "-help" output text.
|
||||||
|
BugFix: Tab navigation improvements.
|
||||||
|
BugFix: Statusbar showed a number of packages when the list was empty (the previous value).
|
||||||
|
BugFix: Clicking on printed outdated packages in Output tab did not send to corresponding
|
||||||
|
package in the main list after a 'Check updates'.
|
||||||
|
BugFix: WM detection now uses "ps -aux".
|
||||||
|
|
||||||
|
0.10.0 (2020-07-19)
|
||||||
|
Added a built-in default priviledge escalation tool: "octopi-sudo" as a slightly modified version
|
||||||
|
of "lxqt-sudo" project (version 0.15.0). It's the only escalation tool supported!
|
||||||
|
Added option to vote/unvote for AUR packages using aur.archlinux.org login.
|
||||||
|
Added "pikaur" AUR tool support (thanks to ewilly).
|
||||||
|
Added "yay" AUR tool support.
|
||||||
|
Added option "--devel" in AUR tab to check for newer versions of dev packages.
|
||||||
|
Added option to download a temporary yay-bin to enable AUR.
|
||||||
|
Updated some UI icons and added an specific one for foreign non installed pkg.
|
||||||
|
Dropped support for external terminal applications. QTermWidget is mandatory now!
|
||||||
|
Print ".pacnew" file list summary after upgrade (if any).
|
||||||
|
Added Lumina desktop support.
|
||||||
|
RepoEditor now saves window size and position.
|
||||||
|
Added "copy" command to octopi's embedded terminal context menu.
|
||||||
|
Added option to enable/disable confirmation dialog in system upgrade.
|
||||||
|
Added option to enable/disable internet checking.
|
||||||
|
Renamed Transaction tab to Actions tab.
|
||||||
|
Added left click support on package icon in package list to launch context menu.
|
||||||
|
Added option to never check for package updates in Notifier.
|
||||||
|
Added tooltip "Upgrading..." while Notifier is upgrading the system.
|
||||||
|
Added "Info" option in package list context menu.
|
||||||
|
Added ArcoLinux, Artix Linux, CondresOS and EndeavourOS distro support.
|
||||||
|
Added support for sudo (and NOPASSWD) executing thru new octopi-helper subproject.
|
||||||
|
Added option to exit Octopi while a transaction is already running.
|
||||||
|
Added support for GNOME file manager/editor.
|
||||||
|
Added option for changing use of alternating row colors in package list.
|
||||||
|
Added a redesigned AUR tab in Options dialog.
|
||||||
|
Added option to change terminal's color scheme, font family and font size through ~/.config/octopi/octopi.conf.
|
||||||
|
Maximization of properties pane now hides tab bar.
|
||||||
|
BugFix: Many clazy/manual code enhancements merged from luis-pereira (from LXQt organization).
|
||||||
|
BugFix: AUR upgrades in notifier were not setting m_commandExecuting flag.
|
||||||
|
BugFix: Make notifier code consistent with AUR upgrades.
|
||||||
|
BugFix: Replaced 'Sync database' command text to 'Check updates'.
|
||||||
|
BugFix: Always do a "pacman -Syu" in System Upgrade.
|
||||||
|
BugFix: Notifier now uses "checkupdates" instead "pacman -Sy[y]". This means Octopi no longer can lead
|
||||||
|
the OS to a "partial updates" state and works gracefully with other package tools.
|
||||||
|
BugFix: Don't let user exits RepoEditor without answerig if he wants to save changes.
|
||||||
|
BugFix: Sometimes non-outdated AUR packages did not get refreshed.
|
||||||
|
BugFix: Now Actions tab is disable while in AUR mode.
|
||||||
|
BugFix: Make "Open terminal here" option work with qtermwidget.
|
||||||
|
BugFix: Added support for symbolic lynks in "open file".
|
||||||
|
BugFix: Pkg build date obeys Locale datetime format.
|
||||||
|
BugFix: SysInfo no longer pushes the collected logs to a remote paste service. It saves them locally.
|
||||||
|
BugFix: "exists in filesystem" messages during transactions are shown again.
|
||||||
|
BugFix: MultiselectionDialog did not resize pkg description automatically.
|
||||||
|
BugFix: Some packages were not displaying Optional Deps at Info tab.
|
||||||
|
BugFix: Huge delay when scrolling thru large package list.
|
||||||
|
BugFix: Speed improvements in package list building.
|
||||||
|
BugFix: OptionsDialog was not saving AUR settings if tab changed before clicking OK.
|
||||||
|
BugFix: Changed Manjaro news url.
|
||||||
|
BugFix: Notifier checked for available internet connection too early with an error dialog box.
|
||||||
|
BugFix: Changed command string to Reinstall/Update when package is already installed or outdated.
|
||||||
|
BugFix: Clear filter line edit when navigating thru package anchors at Info tab.
|
||||||
|
BugFix: Info and Files tabs were not showing any info automaticaly when switching between
|
||||||
|
foreign tool/pacman lists.
|
||||||
|
BugFix: Enable a more complete UI lockdown during transactions.
|
||||||
|
BugFix: Enable "Find a file" context menu option on a non installed pkg.
|
||||||
|
|
||||||
|
0.9.0 (2018-06-08)
|
||||||
|
Parser changes: added counter for processed packages.
|
||||||
|
Group pane now spans all window's height.
|
||||||
|
SysInfo now uses ptpb site and does not block interface.
|
||||||
|
Added Trizen (AUR tool) support.
|
||||||
|
Added Terminal tab if user compiles project with libqtermwidget5 support.
|
||||||
|
Added Terminal dialog in Notifier (AUR update) if user compiles project with
|
||||||
|
libqtermwidget5 support.
|
||||||
|
Added an Options dialog to Octopi and Notifier.
|
||||||
|
Added button after progressbar to stop current running transaction.
|
||||||
|
Added configurable "--noconfirm" and "--noedit" options to pacaur and "--noconfirm" to yaourt.
|
||||||
|
Added "Search/Use Instant Search" toggle.
|
||||||
|
Added slovenian translation (thanks to the translation crew).
|
||||||
|
Added support fo drag pacman packages to Octopi's mainwindow so they can be installed.
|
||||||
|
Added "Install Reason" field at Info tab.
|
||||||
|
Added support for ALPM utils lib (thanks to guinux, from Pamac project). So, now it's possible to
|
||||||
|
show "Download Size" in package list.
|
||||||
|
Added link support in all Info tab package lists.
|
||||||
|
Added option to upgrade outdated foreign packages from Octopi Notifier.
|
||||||
|
Added Hindi translation (thanks to Panwar108).
|
||||||
|
Name of AUR package in Info tab act as link to its site at https://aur.archlinux.org.
|
||||||
|
Search line edit is always focused when the program starts.
|
||||||
|
Prevent user to install partial upgrades in his system (ex: only some of the outdated packages).
|
||||||
|
Do NOT clear search string when switching between AUR/pacman.
|
||||||
|
BugFix: If threre are updated News after a synchronization, let's goto the News Tab.
|
||||||
|
BugFix: Remove only Octopi tools related temporary files (qtsingleapp*).
|
||||||
|
BugFix: Do not let program display an avalanche of internet related errors.
|
||||||
|
BugFix: Exec internet tests before some commands in Octopi and Notifier.
|
||||||
|
BugFix: Parser was not outputing repository errors when syncinc.
|
||||||
|
BugFix: repoeditor now runs as normal user and asks for root password on save.
|
||||||
|
BugFix: If Notifier hid Octopi and was closed, Octopi's window would stay hidden.
|
||||||
|
BugFix: Notifier's about dialog was never screen centered.
|
||||||
|
BugFix: When no AUR helper exists, the group of packages panel stayed disabled.
|
||||||
|
BugFix: Cache Cleaner now saves its window geometry.
|
||||||
|
BugFix: Infinite wait cursor in Cache Cleaner when user press Enter for more than two
|
||||||
|
seconds in the spin boxes.
|
||||||
|
BugFix: Some pkg download/installed sizes were not showing properly at Info tab.
|
||||||
|
BugFix: If we find an outdated AUR pkg in the official pkg list, we remove it.
|
||||||
|
BugFix: Install local packages did not work with space separated paths
|
||||||
|
(thanks to voanhcuoc for pointing it out).
|
||||||
|
BugFix: About and System Upgrade dialogs could be opened twice in notifier.
|
||||||
|
BugFix: Max time in minutes for notification interval was not honoring > 1380.
|
||||||
|
BugFix: Optional dependencies dialog can now be resized and new value is
|
||||||
|
persisted on disk.
|
||||||
|
BugFix: Using the alpm algorithm for package version comparison. Previous code
|
||||||
|
was reporting false newer packages.
|
||||||
|
BugFix: System upgrade button was not disabled while synching packages in notifier.
|
||||||
|
BugFix: searchlineedit font fix.
|
||||||
|
BugFix: 'yaourt' and 'pacaur' no longer honor "-a" option when querying outdated
|
||||||
|
foreign packages.
|
||||||
|
BugFix: System upgrade shortcut changed to "ctrl+P" as "ctrl+U" is used to cut text in
|
||||||
|
QLineEdit widgets.
|
||||||
|
BugFix: When user selected another search option, line edit was not being cleared.
|
||||||
|
BugFix: Disable alien icon while in transaction.
|
||||||
|
BugFix: Do not ask twice for password if a pacman lck file exists.
|
||||||
|
|
||||||
|
0.8.1 (2016-03-27)
|
||||||
|
BugFix: Updated CHAKRA RSS site (thanks to s8321414).
|
||||||
|
BugFix: Distro news now works with https KaOS site.
|
||||||
|
BugFix: Files tab was not refreshing when enabling KCP mode in KaOS.
|
||||||
|
BugFix: Do not permit two or more octopi instances if one is in root mode.
|
||||||
|
BugFix: When there's a pkg change outside Octopi, we trigger a flag to refresh the lists.
|
||||||
|
BugFix: When you were searching for a pkg and the Files tab was selected, focus got lost.
|
||||||
|
BugFix: Package dependencies with >, <, =, >= and <= signals were not clickable in Info tab.
|
||||||
|
BugFix: When user commits a transaction, commit and cancel buttons must get disabled.
|
||||||
|
Package list now also preserves sort column and sort order while in AUR/KCP/CCR mode.
|
||||||
|
Make Octopi more keyboard friendly.
|
||||||
|
Pressing <ENTER>, <RETURN> and <DELETE> keys on package list triggers package actions.
|
||||||
|
Stop using 'notify-send' in octopi-notifier: the era of annoying notifiers is over.
|
||||||
|
Major refactoring: Decoupling of Pacman executor and parser code from the UI as well as
|
||||||
|
SearchBar slots for QTextBrowser objects.
|
||||||
|
Added URL information to yaourt/pacaur remote pkgs at Info tab.
|
||||||
|
Added <F2> shortcut to focus package list.
|
||||||
|
Added an output dialog to notifier, so users can do a system upgrade without a terminal.
|
||||||
|
Added an entry for Mirror-check in Tools menu.
|
||||||
|
Added support for Simplified Chinese (zh_CN).
|
||||||
|
Added support for lxqt-sudo tool (thanks to Manjaro team).
|
||||||
|
Added "pkgfile -u" (if available) in sync db transaction.
|
||||||
|
|
||||||
|
0.8.0 (2015-11-08)
|
||||||
|
This is a Qt5 only version (with the exception of 'octopi-notifier').
|
||||||
|
BugFix: Speed optimizations in startup code (AUR outdated list).
|
||||||
|
BugFix: Octopi now honors the $SHELL variable (thanks to LAC1213).
|
||||||
|
BugFix: If user refused to remove pacman's lock file, commands
|
||||||
|
should be canceled!
|
||||||
|
BugFix: Sync Interval dialog was not showing strings in some languages.
|
||||||
|
BugFix: Package counters were not zeroing when searches found no results.
|
||||||
|
BugFix: In some very specific situations Info tab did not refresh info of
|
||||||
|
selected package.
|
||||||
|
BugFix: If user tried to sync db with kdesu and clicked "ESC", some garbage
|
||||||
|
went to Output tab.
|
||||||
|
BugFix: When user closed searchbar inside a QTextBrowser, cursor position was
|
||||||
|
reseted.
|
||||||
|
BugFix: Transaction dialog can now be resized and new value is persisted on disk.
|
||||||
|
BugFix: No columns warning while executing actions inside Octopi (thanks to flying-sheep).
|
||||||
|
BugFix: Cinnamon DE detection fix (thanks to jdelmas).
|
||||||
|
BugFix: Added option to search files with "\+" (escaping the plus sign). This would find things such
|
||||||
|
as C++ => "c\+\+" (thanks to maxis11).
|
||||||
|
Added support to "kcp --information" at Info tab.
|
||||||
|
Now Files tab shows a progressbar while building the list of files.
|
||||||
|
Yellow notifier icon tooltip now displays Foreign repo tool name.
|
||||||
|
When outdated packages are printed at Output tab, you can see their
|
||||||
|
information just hovering the mouse over them.
|
||||||
|
Added Parabola GNU/Linux-libre support (thanks to coadde).
|
||||||
|
Added galician translation (thanks to Ismael Ordóñez).
|
||||||
|
At Info tab, packages in "depends On" field are shown as clickable anchors.
|
||||||
|
Information tab now supports "ctrl+F" searching.
|
||||||
|
Help/About dialog now shows Pacman information.
|
||||||
|
StatusBar msg got updated with number of selected packages more visible.
|
||||||
|
|
||||||
|
0.7.0 (2015-04-27)
|
||||||
|
Major speed fix: Faster pkg list building.
|
||||||
|
Reverted to showing ALL packages at startup.
|
||||||
|
Added a systemd service to speed up the very first octopi startup time.
|
||||||
|
Added "Copy path to clipboard" context menu option in file list treeview.
|
||||||
|
Now pacman.conf's "IgnoreGroup" option is honored.
|
||||||
|
Disabled "View/Repository/[kcp | aur]" menu item.
|
||||||
|
Toolbar now shows AUR tool button instead of a fake pacman group.
|
||||||
|
Reenabled Pacaur support.
|
||||||
|
Now Package treeview columns get their widths saved.
|
||||||
|
Remove "Yes" button from transaction dialog, everytime 'pacman'
|
||||||
|
is one of the target packages.
|
||||||
|
SearchBar now reacts to an ENTER or RETURN key press to search for
|
||||||
|
next found item.
|
||||||
|
Added a notifier setup dialog to set "sync database" interval.
|
||||||
|
Generate a system info report if "gist" tool is available.
|
||||||
|
Added a "-d" switch to octopi and notifier to show some debug info.
|
||||||
|
BugFix: No more horizontal scrollbar in AUR mode.
|
||||||
|
BugFix: When a transaction is available, disable sync pkg and system
|
||||||
|
upgrade, as well as mirror-check and AUR mode.
|
||||||
|
BugFix: Repository column would get wider after switching from AUR
|
||||||
|
mode.
|
||||||
|
BugFix: Filter connect chain bug decreased filter's performance over time.
|
||||||
|
BugFix: Search by name was not being used after reverting from AUR search.
|
||||||
|
BugFix: F3 and Shift+F3 keys at SearchBar were not working.
|
||||||
|
BugFix: Sometimes downloaded and installed size information were in KiB,
|
||||||
|
instead of MiB.
|
||||||
|
BugFix: If user had no gksu/kdesu/root when clicking "clean" button in
|
||||||
|
cachecleaner, cursor would remain waiting (thanks to imperator-).
|
||||||
|
|
||||||
|
0.6.0 (2015-02-27)
|
||||||
|
BugFix: Pkg list was being refreshed twice sometimes.
|
||||||
|
BugFix: Removed some buggy strings from Output tab while in KF5.
|
||||||
|
BugFix: ArrowUp/Down, PageUp/Down and Home/End keys now refresh Package Info tab.
|
||||||
|
BugFix: Open file was not working in KF5.
|
||||||
|
BugFix: Filter by repo was not working with Qt 5.4 libs (thanks to sl1pkn07).
|
||||||
|
BugFix: Chakra CCR for installing pkgs was not being called.
|
||||||
|
BugFix: Notifier would not test for internet connection.
|
||||||
|
BugFix: Repoeditor uses user defined translation (if available) while launched from Octopi.
|
||||||
|
BugFix: Honor plural forms in some languages (thanks to SafaAlfulaij).
|
||||||
|
BugFix: When only notifier is installed, we don't refer Octopi in context menu nor
|
||||||
|
system upgrade dialog.
|
||||||
|
BugFix: Removed another buggy string while in plasma5.
|
||||||
|
BugFix: Opens install local pkg when you associate octopi to pacman files.
|
||||||
|
BugFix: PacmanHelper is a project related to Octopi-notifier (fix at PKGBUILD).
|
||||||
|
Always reset to "View ALL/ALL repos" when pkg group is changed.
|
||||||
|
Added more safety checks before running octopi-notifier.
|
||||||
|
Now notifier does not close Octopi.
|
||||||
|
Disabled Pacaur support.
|
||||||
|
Now PKGBUILD defaults to Qt5 builds.
|
||||||
|
At startup only installed packages are shown (if distro is not KaOS).
|
||||||
|
Added cachecleaner, a frontend to 'paccache' (thanks to Michaël Lhomme).
|
||||||
|
Added new KDE detection logic (thanks to Kirek).
|
||||||
|
KaOS only: added support for newer versions of Cellix's awesome KCP tool (much faster).
|
||||||
|
KaOS only: do a "kcp -u" sync while in "sync database" and notifier.
|
||||||
|
Refactorings in SearchLineEdit.
|
||||||
|
BugFixes in RepoEditor translation support (repoeditor is now in Transifex too).
|
||||||
|
|
||||||
|
0.5.0 (2014-11-08)
|
||||||
|
BugFix: RepoEditor would not compile with Qt5 lib (thanks to Philm).
|
||||||
|
BugFix: Suppress GConf error strings in output.
|
||||||
|
BugFix: mate-terminal is returning code 255 even when execution of
|
||||||
|
transaction was ok (thanks to ringo32).
|
||||||
|
BugFix: Keep groups panel hidden (if it were before) after pressing
|
||||||
|
F12 or F10.
|
||||||
|
BugFix: Merged offa's pull request that fixed a bunch of things.
|
||||||
|
BugFix: RepoEditor didn't take into account repo SigLevels while
|
||||||
|
saving .conf files.
|
||||||
|
Added Qt version in About dialog boxes (also in notifier).
|
||||||
|
Changed repoeditor icon to octopi_green.
|
||||||
|
Show/hide groups panel config is now persisted.
|
||||||
|
Now notifier syncs db once a day and save last synced time.
|
||||||
|
Changed package size to MiB when it was > 1024 KiB.
|
||||||
|
Added option "SyncDbHour" so notifier checks only when that specific hour ticks,
|
||||||
|
again once a day.
|
||||||
|
Added "sync db" menu option to notifier.
|
||||||
|
Added support for hiding/showing Octopi window in the new KF5 notifier code.
|
||||||
|
Added support for Ctrl+F in Output tab.
|
||||||
|
Added support for the user to choose his terminal by editing
|
||||||
|
~/.config/octopi/octopi.conf.
|
||||||
|
Added QtQuick code for user change terminal (only if Qt >= 5.3).
|
||||||
|
Added support for KStatusNotifier while in KDE (thanks to brcha).
|
||||||
|
Updated translations.
|
||||||
|
|
||||||
|
0.4.2 (2014-07-26)
|
||||||
|
BugFix: when searching AUR pkgs, given search string was not being matched
|
||||||
|
by package descriptions.
|
||||||
|
BugFix: Sometimes got a gconf bug string at sync db.
|
||||||
|
Updated a bunch of translations.
|
||||||
|
Added support for the new kcp tool (Go version).
|
||||||
|
|
||||||
|
0.4.1 (2014-07-12)
|
||||||
|
Added basque translation (thanks to tarteka).
|
||||||
|
Added es_AR translation (thanks to javier).
|
||||||
|
Added japanese translation (thanks to UTUMI Hirosi - utuhiro78).
|
||||||
|
Some coding refactorings regarding Yaourt/AUR as well as utils namespace.
|
||||||
|
BugFix: Tools menu was not being refreshed after a package
|
||||||
|
removal/installation.
|
||||||
|
BugFix: Ctrl and Shift key pkg actions not behaving right in Qt5
|
||||||
|
builds.
|
||||||
|
BugFix: When clicking a pkg on the outdated list, it could scroll
|
||||||
|
to a wrong pkg info.
|
||||||
|
BugFix: Adapted ArchBang changes.
|
||||||
|
BugFix: Removed unused Ctrl+N help text.
|
||||||
|
BugFix: Some changes in LXQt support.
|
||||||
|
BugFix: Download and installed size info at Info tab.
|
||||||
|
BugFix: The 'Enter' key (numeric keyboard) is now supported.
|
||||||
|
BugFix: At start when there is no pacman db, octopi hangs (thanks to anex).
|
||||||
|
BugFix: After a pkg list rebuild the Files and Info cache were not
|
||||||
|
being emptied.
|
||||||
|
Now downgrading operations appears in orange in Output tab.
|
||||||
|
Small fixes in packagemodel/package code (thanks to tbinkau).
|
||||||
|
Ctrl+C over an item in Files tab copies it's full path to Clipboard.
|
||||||
|
Reworked code to count installed packages (based on filters).
|
||||||
|
Leave some actions disabled before building pkg list and mirror-checking.
|
||||||
|
Added 'installed size' information in package tooltips.
|
||||||
|
Added Search by file feature (pacman -Qo).
|
||||||
|
Added a string validator in the search edit widget.
|
||||||
|
|
||||||
|
0.4.0 (2014-05-24)
|
||||||
|
Huge refactorings in model/view that brings consistent memory and
|
||||||
|
speed improvements - a single model and a central data storage (thanks to
|
||||||
|
Thomas Binkau - tbinkau).
|
||||||
|
BugFix: The transparent octopi notifier icon no longer shows a white bar in the
|
||||||
|
eyes (thanks to Ankde Boersma) .
|
||||||
|
BugFix: Fixed a jump bug when key-navigating in pkg list with Qt5 octopi.
|
||||||
|
BugFix: When a pkg is outdated, show all available information.
|
||||||
|
BugFix: Show warning if user do not have kdesu/gksu in sysupgrade/install local pkgs.
|
||||||
|
BugFix: System upgrade can not be available while in yaourt mode.
|
||||||
|
BugFix: Switching faster to yaourt mode if text field is empty.
|
||||||
|
BugFix: Ctrl+A is available in the package list panel.
|
||||||
|
BugFix: Now Shift+F3 and F3 search keys (and also Esc) work outside
|
||||||
|
SearchLineEdit widget.
|
||||||
|
BugFix: fixed freeze for install orphaned/yaourt package (thanks to
|
||||||
|
tbinkau).
|
||||||
|
BugFix: fixed notify-send code in octopi-notifier (thanks to vedgy).
|
||||||
|
BugFix: Files tab presented some nasty results sometimes and even a GPF when it
|
||||||
|
found symlinks to directories.
|
||||||
|
BugFix: running as root was broken in KDE.
|
||||||
|
BugFix: The preventing code for always refresh the pkg list was flawed.
|
||||||
|
BugFix: hasInternetConnection code fixed to improve mirror-check speed.
|
||||||
|
BugFix: Fixed CCR (Chakra) package installation/removal (thanks to dmnmsc).
|
||||||
|
BugFix: Disable group widget while searching for AUR packages.
|
||||||
|
Switched to "pacman -Syy" command when synching. It's safer.
|
||||||
|
Added support for Pacaur tool.
|
||||||
|
Added support to kcp in KaOS (thanks to Cellix).
|
||||||
|
Added support to LXQt DE.
|
||||||
|
Added support to ArchBSD news (thanks to bkc_).
|
||||||
|
Added support to Netrunner news.
|
||||||
|
Added support to mooOS distro (thanks to pdq).
|
||||||
|
Added support to Antergos distro (thanks to Yoyo).
|
||||||
|
Added popularity column (number of votes) in AUR/CCR mode (thanks to
|
||||||
|
tbinkau).
|
||||||
|
Added more filter options in View menu.
|
||||||
|
Added parameter "sysupgrade-noconfirm" so Octopi can jump automatically
|
||||||
|
to distro upgrade (if any new packages available) without prompt for
|
||||||
|
confirmation. Also added a "Yes" button to the sysupgrade
|
||||||
|
confirmation dialog at octopi-notifier (thanks to wget).
|
||||||
|
Merged Oktopi's code for using KDE icon theme, tools menu and CCR support
|
||||||
|
(thanks to Giuseppe Calà - gcala).
|
||||||
|
Changed sorting of the first column to also include the name column as second
|
||||||
|
sort criteria (thanks to tbinkau).
|
||||||
|
Added pacman log viewer and repoeditor support in tools menu (thanks to gcala).
|
||||||
|
Added asturian language in Qt5 builds (thanks to Llumex03).
|
||||||
|
Patched repoeditor to run just one instance at a time.
|
||||||
|
The filelist search now searches directories too.
|
||||||
|
Refactorings here and there to make it more Chakra friendly.
|
||||||
|
Updated README file.
|
||||||
|
Updated some icons to unclutter the UI (thanks to Anke Boersma).
|
||||||
|
Refactoring in some code to not generate translatable strings.
|
||||||
|
Fixed getBuildDate code to always convert dates to english format.
|
||||||
|
Updated some translations.
|
||||||
|
|
||||||
|
0.3.2 (2014-02-14)
|
||||||
|
Cleaned unused code.
|
||||||
|
Added icon for mirror-check while in KaOS.
|
||||||
|
Does a mirror-check at startup while in KaOS.
|
||||||
|
Added icon for system upgrade.
|
||||||
|
Added system upgrade button in octopi's toolbar.
|
||||||
|
BugFix: Navigating in the package list using [A..Z] keys did not work as
|
||||||
|
expected.
|
||||||
|
BugFix: When the package list is filtered and you click in a package which is in
|
||||||
|
the outdated package list, you are redirected to a blank information tab.
|
||||||
|
BugFix: When the groups button is pressed and the lower pane is maximized, the
|
||||||
|
former is hidden by the later.
|
||||||
|
BugFix: When the user had no yaourt in the system, there were a zombie
|
||||||
|
octopi process 'left running'.
|
||||||
|
|
||||||
|
0.3.1 (2014-01-14)
|
||||||
|
Added support for Qt5.
|
||||||
|
Added chinese (Taiwan), malay, slovak and ukrainian translations.
|
||||||
|
Added support to KaOS, a lean KDE centric Linux distro.
|
||||||
|
Added support to installation of local packages with GUI feedback.
|
||||||
|
Updated translations.
|
||||||
|
Changed widget for package groups, from combobox to treeview.
|
||||||
|
BugFix: When inserting an optional dependency package or removing a dep,
|
||||||
|
first searches into transaction queue for them.
|
||||||
|
BugFix: Prevent header resizing in File and Transaction tabs.
|
||||||
|
|
||||||
|
0.3.0 (2013-11-03)
|
||||||
|
Code cleanings.
|
||||||
|
BugFix: No need to refresh package list after a cache clean.
|
||||||
|
BugFix: Konsole was not working with yaourt package installation.
|
||||||
|
BugFix: Position of search icon in searchedit sometimes was wrong.
|
||||||
|
BugFix: Some actions did not get disabled while executing a transaction.
|
||||||
|
BugFix: Use -Ss option while searching for yaourt packages.
|
||||||
|
BugFix: Don't show package names in yaourt package descriptions.
|
||||||
|
BugFix: Better RazorQt compatibility.
|
||||||
|
BugFix: Notifier: clear tooltip if no update is available (thanks to
|
||||||
|
Anselmo L. S. Melo - anselmolsm).
|
||||||
|
BugFix: When refreshing packages from a group, the list could become
|
||||||
|
outdated if the user had installed/removed some package.
|
||||||
|
BugFix: Use "yaourt -S aur/pkgname" to install yaourt packages
|
||||||
|
(thanks to ringo32).
|
||||||
|
BugFix: Octopi was only showing the first Optional Deps in some cases.
|
||||||
|
Brought back the option to do a graphical system upgrade.
|
||||||
|
Now when installing a package with optional dependencies, Octopi lets users choose
|
||||||
|
which optional dependencies (if any) they want to install.
|
||||||
|
Now when removing a package with dependencies, Octopi lets users choose which one they
|
||||||
|
want to remove.
|
||||||
|
Now Get Latest Distro News doesn't freeze the interface.
|
||||||
|
Changed octopi main icon to octopi-green.png in PKGBUILD and
|
||||||
|
octopi.desktop.
|
||||||
|
Added menu "Octopi" and "System Upgrade" in octopi-notifier.
|
||||||
|
Show Yaourt packages as outdated in default package list.
|
||||||
|
Now it's possible to upgrade Yaourt packages even outside Yaourt group.
|
||||||
|
Now the yellow octopi icon means there are outdated yaourt packages.
|
||||||
|
Now octopi-notifier opens only the transaction dialog if Octopi is not running
|
||||||
|
and user requests a system upgrade.
|
||||||
|
Added support to remove Pacman's transaction lock file.
|
||||||
|
Added a new notification for outdated packages on statusbar.
|
||||||
|
Added a new status icon: an orange one for newer than repo
|
||||||
|
installed packages.
|
||||||
|
Added spanish (Latin America) translation.
|
||||||
|
Added english (Great Britain) translation.
|
||||||
|
Added portuguese (Portugal) translation.
|
||||||
|
Added swedish translation.
|
||||||
|
Added serbian translation.
|
||||||
|
Added hungarian translation.
|
||||||
|
Added new "foreign_red.png" and "octopi_green.png" icons (thanks to Alex
|
||||||
|
Fredrich).
|
||||||
|
Added support for pkgfile to view uninstalled package file list while in
|
||||||
|
ArchLinux/ArchBang (thanks to Damián Nohales).
|
||||||
|
Added an About Dialog to Octopi Notifier.
|
||||||
|
Updated translations.
|
||||||
|
|
||||||
|
0.2.0 (2013-08-24)
|
||||||
|
Splitted the project in "octopi" and "octopi-notifier".
|
||||||
|
Yaourt no longer runs with root permissions.
|
||||||
|
Added support for package multi selection in Yaourt mode.
|
||||||
|
Added option to install local packages.
|
||||||
|
Added support for "notify-send" in "octopi-notifier".
|
||||||
|
Added hebrew translation.
|
||||||
|
Added lithuanian translation.
|
||||||
|
Added norwegian bokmål translation.
|
||||||
|
Added servian latin translation.
|
||||||
|
Added dutch translation.
|
||||||
|
Added russian translation.
|
||||||
|
Added uzbek translation.
|
||||||
|
Added finnish translation.
|
||||||
|
Added vietnamese translation.
|
||||||
|
Updated all other translations.
|
||||||
|
GTK native theme is used by default in Manjaro (while not in KDE).
|
||||||
|
Added support for Xterm terminal.
|
||||||
|
IgnorePkg option is now used to build outdated package list.
|
||||||
|
BugFix: Empty pkg descriptions are now shown as empty.
|
||||||
|
|
||||||
|
0.1.9.1 (2013-07-14)
|
||||||
|
Important bugfixes to deal with multithreaded code.
|
||||||
|
Added a "globals.h/.cpp" file to group QFutureWatcher globals.
|
||||||
|
Updated style changing code in main.cpp.
|
||||||
|
BugFix: when user cancelled a sysupgrade transaction inside a
|
||||||
|
terminal, the package actions remained disabled.
|
||||||
|
|
||||||
|
0.1.9 (2013-07-09)
|
||||||
|
Added yaourt support.
|
||||||
|
Updated most of the translations.
|
||||||
|
|
||||||
|
0.1.8 (2013-06-16)
|
||||||
|
Added czech translation.
|
||||||
|
Added support to ArchBang Linux.
|
||||||
|
Added a systemtray icon notifier feature using DBus technology.
|
||||||
|
|
||||||
|
0.1.7.3 (2013-05-26)
|
||||||
|
Added a TRANSLATIONS file.
|
||||||
|
Added danish translation.
|
||||||
|
Added indonesian translation.
|
||||||
|
Added polish translation.
|
||||||
|
Added bulgarian translation.
|
||||||
|
sysupgrade command line option now synchronizes database.
|
||||||
|
Bugfix: sysupgrade must refresh packagelist after syncdatabase.
|
||||||
|
Bugfix: if sysupgrade uses SyncFirst, makes it automatically start a second upgrade.
|
||||||
|
|
||||||
|
0.1.7.2 (2013-05-17)
|
||||||
|
Added catalan translation.
|
||||||
|
Bugfix: updated new binary translation files to the resources.
|
||||||
|
|
||||||
|
0.1.7.1 (2013-05-11)
|
||||||
|
Bugfix: menu icons were not being shown while in Xfce.
|
||||||
|
|
||||||
|
0.1.7 (2013-05-11)
|
||||||
|
Added "-sysupgrade" command line option.
|
||||||
|
Added "-removecmd" command line option.
|
||||||
|
Added lots of translations.
|
||||||
|
Added links to outdated package names in outdated package list.
|
||||||
|
Added an About dialog.
|
||||||
|
Changed the old About tab to Usage tab.
|
||||||
|
|
||||||
|
0.1.6.1 (2013-04-25)
|
||||||
|
Added pt_BR translation.
|
||||||
|
Added "Open root terminal" option in File menu.
|
||||||
|
|
||||||
|
0.1.6 (2013-04-12)
|
||||||
Added a new Transaction Dialog.
|
Added a new Transaction Dialog.
|
||||||
Added a Firefox-like search inside Files, News and About tabs.
|
Added a Firefox-like search inside Files, News and About tabs.
|
||||||
Added support for Chakra.
|
Added support for Chakra.
|
||||||
@@ -6,33 +672,33 @@
|
|||||||
Added option to execute any transaction inside a terminal.
|
Added option to execute any transaction inside a terminal.
|
||||||
Changed ProgressDialog to a progressBar at the screen bottom.
|
Changed ProgressDialog to a progressBar at the screen bottom.
|
||||||
|
|
||||||
0.1.5
|
0.1.5 (2013-04-06)
|
||||||
Added option to search packages by description and name.
|
Added option to search packages by description and name.
|
||||||
Added support for pacman version 4.1.
|
Added support for pacman version 4.1.
|
||||||
Transactions with conflict errors can be re-executed inside a terminal.
|
Transactions with conflict errors can be re-executed inside a terminal.
|
||||||
Reworked Manjaro Linux theme.
|
Reworked Manjaro Linux theme.
|
||||||
|
|
||||||
0.1.4.1
|
0.1.4.1 (2013-03-30)
|
||||||
Bugfix release
|
Bugfix release
|
||||||
Added total download size information in transaction dialog.
|
Added total download size information in transaction dialog.
|
||||||
|
|
||||||
0.1.4
|
0.1.4 (2013-03-28)
|
||||||
Added a Manjaro Linux theme.
|
Added a Manjaro Linux theme.
|
||||||
Changed position of filter line edit to the toolbar.
|
Changed position of filter line edit to the toolbar.
|
||||||
|
|
||||||
0.1.3
|
0.1.3 (2013-03-19)
|
||||||
Added better support to Qt dark themes.
|
Added better support to Qt dark themes.
|
||||||
Added context menu support inside Files tab.
|
Added context menu support inside Files tab.
|
||||||
Made URLs clickable inside output tab.
|
Made URLs clickable inside Output tab.
|
||||||
Fixed the annoying Packager information display bug.
|
Fixed the annoying Packager information display bug.
|
||||||
|
|
||||||
0.1.2
|
0.1.2 (2013-03-18)
|
||||||
Tons of refactorings and bugfixes.
|
Tons of refactorings and bugfixes.
|
||||||
Small changes in UI.
|
Small changes in UI.
|
||||||
|
|
||||||
0.1.1
|
0.1.1 (2013-03-17)
|
||||||
Added all six tabs.
|
Added all six tabs.
|
||||||
Added support for groups of packages.
|
Added support for groups of packages.
|
||||||
|
|
||||||
0.1.0
|
0.1.0 (2013-03-11)
|
||||||
Initial Proof of Concept release.
|
Initial Proof of Concept release.
|
||||||
|
|||||||
130
CMakeLists.txt
Normal file
130
CMakeLists.txt
Normal file
@@ -0,0 +1,130 @@
|
|||||||
|
cmake_minimum_required(VERSION 3.5)
|
||||||
|
project(octopi VERSION 0.19.0 LANGUAGES CXX)
|
||||||
|
|
||||||
|
set(CMAKE_CXX_STANDARD 17)
|
||||||
|
set(CMAKE_CXX_STANDARD_REQUIRED ON)
|
||||||
|
set(CMAKE_THREAD_PREFER_PTHREAD True)
|
||||||
|
set(CMAKE_RUNTIME_OUTPUT_DIRECTORY "${CMAKE_CURRENT_BINARY_DIR}")
|
||||||
|
|
||||||
|
option(USE_QTERMWIDGET6 "Build with qtermwidget6 instead of qtermwidget5" ON)
|
||||||
|
|
||||||
|
add_subdirectory(helper)
|
||||||
|
add_subdirectory(notifier)
|
||||||
|
add_subdirectory(cachecleaner)
|
||||||
|
add_subdirectory(repoeditor)
|
||||||
|
|
||||||
|
if (USE_QTERMWIDGET6)
|
||||||
|
find_package(Qt6 REQUIRED COMPONENTS Core Core5Compat Gui Network Xml Widgets LinguistTools Multimedia)
|
||||||
|
find_package(qtermwidget6 REQUIRED)
|
||||||
|
else()
|
||||||
|
find_package(Qt5 REQUIRED COMPONENTS Core Gui Network Xml Widgets LinguistTools Multimedia)
|
||||||
|
find_package(qtermwidget5 REQUIRED)
|
||||||
|
endif()
|
||||||
|
|
||||||
|
find_package(alpm_octopi_utils REQUIRED)
|
||||||
|
|
||||||
|
set(CMAKE_AUTOMOC ON)
|
||||||
|
|
||||||
|
file(GLOB TS_FILES LIST_DIRECTORIES false "${CMAKE_CURRENT_LIST_DIR}/resources/translations/*.ts")
|
||||||
|
qt_add_translation(qmFiles ${TS_FILES})
|
||||||
|
|
||||||
|
set(src
|
||||||
|
src/QtSolutions/qtsingleapplication.cpp
|
||||||
|
src/QtSolutions/qtlocalpeer.cpp
|
||||||
|
repoeditor/repoentry.cpp
|
||||||
|
src/aurvote.cpp
|
||||||
|
src/propertiestabwidget.cpp
|
||||||
|
src/qaesencryption.cpp
|
||||||
|
src/repoconf.cpp
|
||||||
|
src/main.cpp
|
||||||
|
src/mainwindow.cpp
|
||||||
|
src/strconstants.cpp
|
||||||
|
src/searchlineedit.cpp
|
||||||
|
src/argumentlist.cpp
|
||||||
|
src/settingsmanager.cpp
|
||||||
|
src/package.cpp
|
||||||
|
src/unixcommand.cpp
|
||||||
|
src/wmhelper.cpp
|
||||||
|
src/treeviewpackagesitemdelegate.cpp
|
||||||
|
src/mainwindow_init.cpp
|
||||||
|
src/mainwindow_transaction.cpp
|
||||||
|
src/mainwindow_events.cpp
|
||||||
|
src/mainwindow_help.cpp
|
||||||
|
src/searchbar.cpp
|
||||||
|
src/mainwindow_searchbar.cpp
|
||||||
|
src/transactiondialog.cpp
|
||||||
|
src/mainwindow_news.cpp
|
||||||
|
src/mainwindow_refresh.cpp
|
||||||
|
src/globals.cpp
|
||||||
|
src/multiselectiondialog.cpp
|
||||||
|
src/packagerepository.cpp
|
||||||
|
src/model/packagemodel.cpp
|
||||||
|
src/ui/octopitabinfo.cpp
|
||||||
|
src/utils.cpp
|
||||||
|
src/terminal.cpp
|
||||||
|
src/pacmanexec.cpp
|
||||||
|
src/optionsdialog.cpp
|
||||||
|
src/packagetreeview.cpp
|
||||||
|
src/termwidget.cpp
|
||||||
|
src/alpmbackend.cpp)
|
||||||
|
|
||||||
|
set(header
|
||||||
|
src/QtSolutions/qtsingleapplication.h
|
||||||
|
src/QtSolutions/qtlocalpeer.h
|
||||||
|
repoeditor/repoentry.h
|
||||||
|
src/aurvote.h
|
||||||
|
src/propertiestabwidget.h
|
||||||
|
src/qaesencryption.h
|
||||||
|
src/repoconf.h
|
||||||
|
src/mainwindow.h
|
||||||
|
src/strconstants.h
|
||||||
|
src/searchlineedit.h
|
||||||
|
src/argumentlist.h
|
||||||
|
src/settingsmanager.h
|
||||||
|
src/uihelper.h
|
||||||
|
src/package.h
|
||||||
|
src/unixcommand.h
|
||||||
|
src/wmhelper.h
|
||||||
|
src/treeviewpackagesitemdelegate.h
|
||||||
|
src/searchbar.h
|
||||||
|
src/transactiondialog.h
|
||||||
|
src/globals.h
|
||||||
|
src/multiselectiondialog.h
|
||||||
|
src/packagerepository.h
|
||||||
|
src/model/packagemodel.h
|
||||||
|
src/ui/octopitabinfo.h
|
||||||
|
src/utils.h
|
||||||
|
src/terminal.h
|
||||||
|
src/pacmanexec.h
|
||||||
|
src/constants.h
|
||||||
|
src/optionsdialog.h
|
||||||
|
src/packagetreeview.h
|
||||||
|
src/termwidget.h
|
||||||
|
src/alpmbackend.h)
|
||||||
|
|
||||||
|
set(ui ui/mainwindow.ui ui/transactiondialog.ui ui/multiselectiondialog.ui ui/optionsdialog.ui)
|
||||||
|
|
||||||
|
set(qrc resources.qrc)
|
||||||
|
|
||||||
|
qt_wrap_ui(src ${ui})
|
||||||
|
qt_add_resources(src ${qrc})
|
||||||
|
|
||||||
|
add_executable(octopi ${src} ${header} ${qmFiles})
|
||||||
|
target_compile_definitions(octopi PRIVATE OCTOPI_EXTENSIONS ALPM_BACKEND QT_DEPRECATED_WARNINGS QT_USE_QSTRINGBUILDER QT_NO_CAST_FROM_ASCII QT_NO_CAST_TO_ASCII QT_NO_URL_CAST_FROM_STRING QT_NO_CAST_FROM_BYTEARRAY)
|
||||||
|
|
||||||
|
if (USE_QTERMWIDGET6)
|
||||||
|
target_include_directories(octopi PRIVATE ${CMAKE_CURRENT_SOURCE_DIR} ${CMAKE_CURRENT_BINARY_DIR} ${Qt6Core_INCLUDE_DIRS} ${Qt6Gui_INCLUDE_DIRS} ${Qt6Network_INCLUDE_DIRS} ${Qt6Xml_INCLUDE_DIRS} ${Qt6Widgets_INCLUDE_DIRS})
|
||||||
|
target_link_libraries(octopi PRIVATE Qt6::Core Qt6::Gui Qt6::Network Qt6::Xml Qt6::Widgets Qt6::Multimedia qtermwidget6 alpm_octopi_utils)
|
||||||
|
else()
|
||||||
|
target_include_directories(octopi PRIVATE ${CMAKE_CURRENT_SOURCE_DIR} ${CMAKE_CURRENT_BINARY_DIR} ${Qt5Core_INCLUDE_DIRS} ${Qt5Gui_INCLUDE_DIRS} ${Qt5Network_INCLUDE_DIRS} ${Qt5Xml_INCLUDE_DIRS} ${Qt5Widgets_INCLUDE_DIRS})
|
||||||
|
target_link_libraries(octopi PRIVATE Qt5::Core Qt5::Gui Qt5::Network Qt5::Xml Qt5::Widgets Qt5::Multimedia qtermwidget5 alpm_octopi_utils)
|
||||||
|
endif()
|
||||||
|
|
||||||
|
file(COPY "${CMAKE_CURRENT_SOURCE_DIR}/resources/images/octopi_green.png" DESTINATION "${CMAKE_CURRENT_BINARY_DIR}")
|
||||||
|
file(RENAME "${CMAKE_CURRENT_BINARY_DIR}/octopi_green.png" "${CMAKE_CURRENT_BINARY_DIR}/octopi.png")
|
||||||
|
install(TARGETS octopi RUNTIME DESTINATION bin LIBRARY DESTINATION lib PUBLIC_HEADER DESTINATION include)
|
||||||
|
install(FILES "${CMAKE_CURRENT_SOURCE_DIR}/octopi.desktop" DESTINATION share/applications)
|
||||||
|
install(FILES "${CMAKE_CURRENT_BINARY_DIR}/octopi.png" "${CMAKE_CURRENT_SOURCE_DIR}/resources/images/octopi_green.png" DESTINATION share/icons/hicolor/48x48/apps)
|
||||||
|
install(FILES "${CMAKE_CURRENT_BINARY_DIR}/octopi.png" "${CMAKE_CURRENT_SOURCE_DIR}/resources/images/octopi_green.png"
|
||||||
|
"${CMAKE_CURRENT_SOURCE_DIR}/resources/images/octopi_red.png" "${CMAKE_CURRENT_SOURCE_DIR}/resources/images/octopi_yellow.png" DESTINATION share/icons/hicolor/48x48/apps)
|
||||||
|
install(FILES "${CMAKE_CURRENT_SOURCE_DIR}/LICENSE" DESTINATION share/licenses/octopi)
|
||||||
15
INSTALL
15
INSTALL
@@ -1,10 +1,17 @@
|
|||||||
Installing Octopi is a pretty straightforward task.
|
Installing Octopi is a pretty straightforward task.
|
||||||
|
|
||||||
Assuming you have updated Qt4 libs installed in your system, just:
|
Assuming you have updated Qt5 libs installed in your system, all
|
||||||
|
you have to do is run:
|
||||||
|
|
||||||
1) ./qmake
|
makepkg -f
|
||||||
2) make
|
|
||||||
|
Wait for the compilation and then install the generated package (as
|
||||||
|
root), using:
|
||||||
|
|
||||||
|
pacman -U <nameOfTheGeneratedOctopiPackage.tar.[xz|zst]>
|
||||||
|
|
||||||
|
Octopi is located on the system utilities menu of your Desktop
|
||||||
|
Environment.
|
||||||
|
|
||||||
Octopi's binary will be generated in "./bin" dir.
|
|
||||||
|
|
||||||
Enjoy!
|
Enjoy!
|
||||||
53
PKGBUILD
Normal file
53
PKGBUILD
Normal file
@@ -0,0 +1,53 @@
|
|||||||
|
_pkgname=octopi
|
||||||
|
pkgname=octopi-git
|
||||||
|
pkgver=0.19.0.latest
|
||||||
|
pkgrel=1
|
||||||
|
pkgdesc="This is Octopi, a powerful Pacman frontend using Qt libs (git checkout)"
|
||||||
|
url="https://tintaescura.com/projects/octopi/"
|
||||||
|
arch=('i686' 'x86_64')
|
||||||
|
license=('GPL2')
|
||||||
|
depends=('alpm_octopi_utils' 'qtermwidget' 'sudo')
|
||||||
|
makedepends=('git')
|
||||||
|
groups=('system')
|
||||||
|
source=("git+https://github.com/aarnt/octopi.git")
|
||||||
|
md5sums=('SKIP')
|
||||||
|
|
||||||
|
prepare() {
|
||||||
|
cd "${_pkgname}"
|
||||||
|
cp resources/images/octopi_green.png resources/images/octopi.png
|
||||||
|
}
|
||||||
|
|
||||||
|
#pkgver() {
|
||||||
|
# cd "${_pkgname}"
|
||||||
|
# git describe --long --tags --abbrev=7 | sed 's/\([^-]*-g\)/r\1/;s/-/./g;s/^v//'
|
||||||
|
#}
|
||||||
|
|
||||||
|
build() {
|
||||||
|
cd "${_pkgname}"
|
||||||
|
echo "Starting build..."
|
||||||
|
qmake6 PREFIX=/usr QMAKE_CFLAGS="${CFLAGS}" QMAKE_CXXFLAGS="${CXXFLAGS}" QMAKE_LFLAGS="${LDFLAGS}" octopi.pro
|
||||||
|
make
|
||||||
|
|
||||||
|
_subdirs="cachecleaner helper notifier repoeditor"
|
||||||
|
|
||||||
|
for _subdir in $_subdirs; do
|
||||||
|
pushd $_subdir
|
||||||
|
echo "Building octopi-$_subdir..."
|
||||||
|
qmake6 PREFIX=/usr QMAKE_CFLAGS="${CFLAGS}" QMAKE_CXXFLAGS="${CXXFLAGS}" QMAKE_LFLAGS="${LDFLAGS}" "octopi-$_subdir.pro"
|
||||||
|
make
|
||||||
|
popd
|
||||||
|
done
|
||||||
|
}
|
||||||
|
|
||||||
|
package() {
|
||||||
|
cd "${_pkgname}"
|
||||||
|
make INSTALL_ROOT="${pkgdir}" install
|
||||||
|
|
||||||
|
_subdirs="cachecleaner helper notifier repoeditor"
|
||||||
|
|
||||||
|
for _subdir in $_subdirs; do
|
||||||
|
pushd $_subdir
|
||||||
|
make INSTALL_ROOT="${pkgdir}" install
|
||||||
|
popd
|
||||||
|
done
|
||||||
|
}
|
||||||
8
README
8
README
@@ -1,8 +0,0 @@
|
|||||||
This is Octopi, a powerful Pacman frontend using Qt libs.
|
|
||||||
|
|
||||||
The project's source code is hosted at https://github.com/aarnt/octopi.
|
|
||||||
|
|
||||||
You'll need a privilege escalation tool to use it, once running it as
|
|
||||||
root will not work. Octopi supports kdesu and gksu for that.
|
|
||||||
|
|
||||||
Enjoy!
|
|
||||||
148
README.md
Normal file
148
README.md
Normal file
@@ -0,0 +1,148 @@
|
|||||||
|
## This is Octopi, a powerful Pacman/AUR front end using Qt libs.
|
||||||
|
|
||||||
|

|
||||||
|

|
||||||
|

|
||||||
|
|
||||||
|
The project site is hosted on https://tintaescura.com/projects/octopi
|
||||||
|
|
||||||
|
Currently, 11 Linux distros are compatible with it
|
||||||
|
|
||||||
|
* [ArchBang](http://archbang.org/)
|
||||||
|
* [Archcraft](https://archcraft.io/)
|
||||||
|
* [Arch Linux](https://www.archlinux.org/)
|
||||||
|
* [ArcoLinux](https://arcolinux.info/)
|
||||||
|
* [Artix Linux](https://artixlinux.org)
|
||||||
|
* [CachyOS](https://cachyos.org/)
|
||||||
|
* [EndeavourOS](https://endeavouros.com/)
|
||||||
|
* [Garuda Linux](https://garudalinux.org/)
|
||||||
|
* [KaOS](https://kaosx.us/)
|
||||||
|
* [Manjaro](https://manjaro.org/)
|
||||||
|
* [Obarun Linux](https://web.obarun.org/index.php?id=1)
|
||||||
|
|
||||||
|
### What you must install in order to have Octopi fully functional
|
||||||
|
|
||||||
|
You'll need:
|
||||||
|
* [Alpm_octopi_utils](https://github.com/aarnt/alpm_octopi_utils/) library
|
||||||
|
* A helper to execute pacman commands called "octphelper", available on "./helper" dir
|
||||||
|
* A privilege escalation tool called [qt-sudo](https://github.com/aarnt/qt-sudo/)
|
||||||
|
* qtermwidget package, in order to build Octopi with embedded terminal support
|
||||||
|
|
||||||
|
### To install Octopi using pacman
|
||||||
|
|
||||||
|
If Octopi package is available in your distro's repository, you can just type:
|
||||||
|
|
||||||
|
```
|
||||||
|
# pacman -S octopi
|
||||||
|
```
|
||||||
|
|
||||||
|
### Steps to build Octopi source code (qmake)
|
||||||
|
|
||||||
|
Assuming you have vala compiler and Qt6 libs properly installed, follow these steps:
|
||||||
|
|
||||||
|
```
|
||||||
|
$ git clone https://github.com/aarnt/alpm_octopi_utils
|
||||||
|
$ cd alpm_octopi_utils
|
||||||
|
$ make
|
||||||
|
# make install
|
||||||
|
$ cd ..
|
||||||
|
$ git clone https://github.com/aarnt/qt-sudo
|
||||||
|
$ cd qt-sudo
|
||||||
|
$ qmake6
|
||||||
|
$ make
|
||||||
|
# make install
|
||||||
|
$ cd ..
|
||||||
|
$ git clone https://github.com/aarnt/octopi
|
||||||
|
$ cd octopi/helper
|
||||||
|
$ qmake6
|
||||||
|
$ make
|
||||||
|
# make install
|
||||||
|
$ cd ../notifier
|
||||||
|
$ qmake6
|
||||||
|
$ make
|
||||||
|
# make install
|
||||||
|
$ cd ../cachecleaner
|
||||||
|
$ qmake6
|
||||||
|
$ make
|
||||||
|
# make install
|
||||||
|
$ cd ../repoeditor
|
||||||
|
$ qmake6
|
||||||
|
$ make
|
||||||
|
# make install
|
||||||
|
$ cd ..
|
||||||
|
$ qmake6
|
||||||
|
$ make
|
||||||
|
# make install
|
||||||
|
```
|
||||||
|
|
||||||
|
You can also use the available PKGBUILD script that helps you build latest Octopi development version with all its tools(*):
|
||||||
|
|
||||||
|
```
|
||||||
|
$ cd OCTOPI_PATH (where you git cloned the source code)
|
||||||
|
$ makepkg -f
|
||||||
|
```
|
||||||
|
|
||||||
|
(*) It may contain bugs. You have been warned.
|
||||||
|
|
||||||
|
### Steps to build Octopi source code (CMake)
|
||||||
|
|
||||||
|
As an alternative to qmake, Octopi can also be built with CMake. Make sure that at least CMake 3.5 is installed.
|
||||||
|
|
||||||
|
First, build and install alpm_octopi_utils:
|
||||||
|
|
||||||
|
```
|
||||||
|
$ git clone https://github.com/aarnt/alpm_octopi_utils
|
||||||
|
$ cd alpm_octopi_utils
|
||||||
|
$ mkdir build_dir && cd build_dir
|
||||||
|
$ cmake -G "Unix Makefiles" .. -DCMAKE_BUILD_TYPE=Release -DCMAKE_INSTALL_PREFIX=/usr
|
||||||
|
$ make
|
||||||
|
$ sudo make install
|
||||||
|
```
|
||||||
|
|
||||||
|
Next, build and install Octopi:
|
||||||
|
|
||||||
|
```
|
||||||
|
$ git clone https://github.com/aarnt/octopi
|
||||||
|
$ cd octopi
|
||||||
|
$ mkdir build_dir && cd build_dir
|
||||||
|
$ cmake -G "Unix Makefiles" .. -DCMAKE_BUILD_TYPE=Release -DCMAKE_INSTALL_PREFIX=/usr
|
||||||
|
$ make
|
||||||
|
$ sudo make install
|
||||||
|
```
|
||||||
|
|
||||||
|
### To run Octopi
|
||||||
|
|
||||||
|
```
|
||||||
|
$ /usr/bin/octopi
|
||||||
|
```
|
||||||
|
|
||||||
|
### To run Octopi Notifier
|
||||||
|
|
||||||
|
```
|
||||||
|
$ /usr/bin/octopi-notifier
|
||||||
|
```
|
||||||
|
|
||||||
|
### To enable AUR support (that "green alien" icon on toolbar)
|
||||||
|
|
||||||
|
You'll need to install [pacaur](https://github.com/rmarquis/pacaur), [paru](https://github.com/morganamilo/paru),
|
||||||
|
[pikaur](https://github.com/actionless/pikaur), [trizen](https://github.com/trizen/trizen) or
|
||||||
|
[yay](https://github.com/Jguer/yay) in your system.
|
||||||
|
If neither of the previous tools are found Octopi will download latest "yay-bin" github binary.
|
||||||
|
In KaOS, [kcp](https://codeberg.org/bvaudour/kcp) will be supported out of the box.
|
||||||
|
|
||||||
|
### Ways to help/support Octopi
|
||||||
|
|
||||||
|
* You can "Star" it on the Github page - https://github.com/aarnt/octopi/
|
||||||
|
* You can vote in the AUR package available on https://aur.archlinux.org/packages/octopi/
|
||||||
|
* You can translate it to your mother language on https://explore.transifex.com/arnt/octopi/
|
||||||
|
* You can follow author's twitter account on https://twitter.com/aaarnt
|
||||||
|
* You can buy author's technical book (currently in portuguese) about Octopi and Qt5 on
|
||||||
|
http://www.amazon.com.br/Aprendendo-Qt-com-projeto-Octopi-ebook/dp/B015ICHKV6
|
||||||
|
* You can buy author's poem book (currently in portuguese) on meditation, Buddhism, cosmology and other subjects on
|
||||||
|
https://www.amazon.com.br/Avidya-Alexandre-Arnt-ebook/dp/B0965LVWR3
|
||||||
|
* You can write a review about it (text / video)
|
||||||
|
* You can donate money to the author's Paypal - http://sourceforge.net/donate/index.php?group_id=186459
|
||||||
|
* You can join the project ;-)
|
||||||
|
|
||||||
|
|
||||||
|
Enjoy!
|
||||||
17
THANKS
17
THANKS
@@ -1,13 +1,26 @@
|
|||||||
A very special thanks goes to:
|
A very special thanks goes to:
|
||||||
|
|
||||||
- Alex Fredrich, for testing and suggestions
|
- All Octopi translators listed in TRANSLATIONS file!
|
||||||
|
- Alex Fredrich, for testing, suggestions and icons
|
||||||
|
- Anke Boersma (demm), for supporting Octopi in KaOS
|
||||||
- Bernardo M. Savone (Bersil), for testing and spreading the word
|
- Bernardo M. Savone (Bersil), for testing and spreading the word
|
||||||
|
- Damián Nohales (eagleoneraptor), for pkgfile support
|
||||||
- Edgar Aloísio Berger, for spreading the word by email
|
- Edgar Aloísio Berger, for spreading the word by email
|
||||||
|
- Filip Brcic (brcha), for KStatusNotifier support
|
||||||
|
- Giuseppe Calà (gcala), for merging changes from Oktopi's code
|
||||||
|
- Jordi (dmnmsc), for testing in Chakra Linux
|
||||||
|
- Jose Martinez (dsngjoe), for testing under Cinnamon
|
||||||
- Manjaro community, for testing and suggestions
|
- Manjaro community, for testing and suggestions
|
||||||
- Manuel Tortosa, for testing, suggestions and code
|
- Manuel Tortosa, for testing, suggestions and code
|
||||||
- Philip Müller, for testing, patches and suggestions
|
- Philip Müller (philm), for testing, patches and suggestions
|
||||||
|
- pdq, for implementing mooOS compatibility
|
||||||
- Riberti de Almeida Felisbino (Holmes), for spreading the word at Manjaro Linux
|
- Riberti de Almeida Felisbino (Holmes), for spreading the word at Manjaro Linux
|
||||||
Brasil
|
Brasil
|
||||||
|
- Ringo de kroon (ringo32), for testing and lots of suggestions
|
||||||
|
- Sami Korkalainen (Sami-Perkele), for testing and suggestions
|
||||||
|
- Thomas Binkau (tbinkau), for patches and suggestions
|
||||||
- Valdir Rossi Belmonte Filho, for patching the site
|
- Valdir Rossi Belmonte Filho, for patching the site
|
||||||
|
- vedgy, for patches and suggestions
|
||||||
|
- Yoyo Fernández (Yoyo), for spreading the word and testing
|
||||||
|
|
||||||
Octopi has got much better with all your help!
|
Octopi has got much better with all your help!
|
||||||
|
|||||||
45
TRANSLATIONS
Normal file
45
TRANSLATIONS
Normal file
@@ -0,0 +1,45 @@
|
|||||||
|
To get a better picture of who are ALL Octopi translators, please access
|
||||||
|
https://www.transifex.com/projects/p/octopi/. Bellow we have only a small
|
||||||
|
list of them:
|
||||||
|
|
||||||
|
Arabic: karim (Karim Oulad Chalha)
|
||||||
|
Asturian: Llumex03
|
||||||
|
Basque: tarteka (Sergio Moreno)
|
||||||
|
Brazilian Portuguese: arnt (Alexandre Albuquerque Arnt)
|
||||||
|
Bulgarian: loot270 (Galin Iskrenov)
|
||||||
|
Catalan: oriolfa (Oriol Fernandez)
|
||||||
|
Chinese (Taiwan): s8321414 (冥王歐西里斯)
|
||||||
|
Croatian: rokadar (Robert Okadar)
|
||||||
|
Czech: fri
|
||||||
|
Danish: Snubbi (Carl Andersen)
|
||||||
|
Dutch: jsm (Jasper van der Marel)
|
||||||
|
English: source language
|
||||||
|
English (Great Britain): jonathon (J Fernyhough)
|
||||||
|
Finnish: Sami Korkalainen (Sami-Perkele)
|
||||||
|
French: Loubrix (David Roux)
|
||||||
|
Galician: Isorfe (Ismael Ordóñez)
|
||||||
|
German: Veraendert
|
||||||
|
Greek: angel_solomos
|
||||||
|
Hebrew: GenghisKhan
|
||||||
|
Hungarian: lajos (Lajos Pasztor)
|
||||||
|
Indonesian: Se7enTime (Mohamad Hasan Al Banna)
|
||||||
|
Italian: bersil (Bernardo Miguel Savone)
|
||||||
|
Japanese: (UTUMI Hirosi) utuhiro78
|
||||||
|
Lithuanian: liudas (Liudas Ališauskas)
|
||||||
|
Malay: Puretech
|
||||||
|
Norwegian Bokmål: viking60
|
||||||
|
Polish: poker98face (Kuba Kaczmarzyk)
|
||||||
|
Portuguese: arcorreia (António Correia)
|
||||||
|
Romanian: Ayceman (Alexandru Ianu)
|
||||||
|
Russian: macbet (Daniil) and ualmasov (Umidjon Almasov)
|
||||||
|
Serbian: milenkin (Milena Petrović)
|
||||||
|
Serbian-latin: GameBoyT (GameBoy)
|
||||||
|
Slovak: roslav
|
||||||
|
Spanish: tufadorin and yoyo308 (Yoyo Fernández)
|
||||||
|
Spanish - Argentina: (javier)
|
||||||
|
Spanish - Latin America: CostGranda (Cost Granda)
|
||||||
|
Swedish: riiga
|
||||||
|
Turkish: yfdogan (Yusuf Faruk DOĞAN)
|
||||||
|
Ukrainian: zubr139
|
||||||
|
Uzbek: ualmasov (Umidjon Almasov)
|
||||||
|
Vietnamese: ppanhh (Anh Phan)
|
||||||
11
cachecleaner/.tx/config
Normal file
11
cachecleaner/.tx/config
Normal file
@@ -0,0 +1,11 @@
|
|||||||
|
[main]
|
||||||
|
host = https://www.transifex.com
|
||||||
|
|
||||||
|
[o:arnt:p:octopi:r:cachecleaner]
|
||||||
|
file_filter = resources/translations/octopi_cachecleaner_<lang>.ts
|
||||||
|
source_file = resources/translations/octopi_cachecleaner_en.ts
|
||||||
|
source_lang = en
|
||||||
|
type = QT
|
||||||
|
replace_edited_strings = false
|
||||||
|
keep_translations = false
|
||||||
|
|
||||||
66
cachecleaner/CMakeLists.txt
Normal file
66
cachecleaner/CMakeLists.txt
Normal file
@@ -0,0 +1,66 @@
|
|||||||
|
if (USE_QTERMWIDGET6)
|
||||||
|
find_package(Qt6 REQUIRED COMPONENTS Core Network Xml Widgets LinguistTools)
|
||||||
|
else()
|
||||||
|
find_package(Qt5 REQUIRED COMPONENTS Core Network Xml Widgets LinguistTools)
|
||||||
|
endif()
|
||||||
|
|
||||||
|
set(CMAKE_AUTOMOC ON)
|
||||||
|
|
||||||
|
file(GLOB TS_FILES LIST_DIRECTORIES false "${CMAKE_CURRENT_LIST_DIR}/resources/translations/*.ts")
|
||||||
|
qt_add_translation(qmFiles ${TS_FILES})
|
||||||
|
|
||||||
|
set(src
|
||||||
|
main.cpp
|
||||||
|
cachecleaner.cpp
|
||||||
|
packagegroupmodel.cpp
|
||||||
|
../src/strconstants.cpp
|
||||||
|
../src/qaesencryption.cpp
|
||||||
|
../src/unixcommand.cpp
|
||||||
|
../src/wmhelper.cpp
|
||||||
|
../src/terminal.cpp
|
||||||
|
../src/settingsmanager.cpp
|
||||||
|
../src/searchlineedit.cpp
|
||||||
|
../src/utils.cpp
|
||||||
|
../src/package.cpp
|
||||||
|
../src/QtSolutions/qtsingleapplication.cpp
|
||||||
|
../src/QtSolutions/qtlocalpeer.cpp
|
||||||
|
#../src/QtSolutions/qtlockedfile.cpp
|
||||||
|
../src/QtSolutions/qtsinglecoreapplication.cpp)
|
||||||
|
|
||||||
|
set(header
|
||||||
|
cachecleaner.h
|
||||||
|
packagegroupmodel.h
|
||||||
|
../src/strconstants.h
|
||||||
|
../src/qaesencryption.h
|
||||||
|
../src/unixcommand.h
|
||||||
|
../src/wmhelper.h
|
||||||
|
../src/terminal.h
|
||||||
|
../src/settingsmanager.h
|
||||||
|
../src/searchlineedit.h
|
||||||
|
../src/utils.h
|
||||||
|
../src/package.h
|
||||||
|
../src/QtSolutions/qtsingleapplication.h
|
||||||
|
../src/QtSolutions/qtlocalpeer.h
|
||||||
|
#../src/QtSolutions/qtlockedfile.h
|
||||||
|
../src/QtSolutions/qtsinglecoreapplication.h)
|
||||||
|
|
||||||
|
set(ui ui/cachecleaner.ui)
|
||||||
|
|
||||||
|
set(qrc resources.qrc)
|
||||||
|
|
||||||
|
qt_wrap_ui(src ${ui})
|
||||||
|
qt_add_resources(src ${qrc})
|
||||||
|
|
||||||
|
add_executable(octopi-cachecleaner ${src} ${header} ${qmFiles})
|
||||||
|
target_compile_definitions(octopi-cachecleaner PRIVATE QT_USE_QSTRINGBUILDER QT_NO_CAST_FROM_ASCII QT_NO_CAST_TO_ASCII QT_NO_URL_CAST_FROM_STRING QT_NO_CAST_FROM_BYTEARRAY)
|
||||||
|
|
||||||
|
if (USE_QTERMWIDGET6)
|
||||||
|
target_include_directories(octopi-cachecleaner PRIVATE ${CMAKE_CURRENT_BINARY_DIR} "${CMAKE_CURRENT_SOURCE_DIR}/src/QtSolutions" ${Qt6Core_INCLUDE_DIRS} ${Qt6Network_INCLUDE_DIRS} ${Qt6Xml_INCLUDE_DIRS} ${Qt6Widgets_INCLUDE_DIRS})
|
||||||
|
target_link_libraries(octopi-cachecleaner PRIVATE Qt6::Core Qt6::Network Qt6::Xml Qt6::Widgets)
|
||||||
|
else()
|
||||||
|
target_include_directories(octopi-cachecleaner PRIVATE ${CMAKE_CURRENT_BINARY_DIR} "${CMAKE_CURRENT_SOURCE_DIR}/src/QtSolutions" ${Qt5Core_INCLUDE_DIRS} ${Qt5Network_INCLUDE_DIRS} ${Qt5Xml_INCLUDE_DIRS} ${Qt5Widgets_INCLUDE_DIRS})
|
||||||
|
target_link_libraries(octopi-cachecleaner PRIVATE Qt5::Core Qt5::Network Qt5::Xml Qt5::Widgets)
|
||||||
|
endif()
|
||||||
|
|
||||||
|
install(TARGETS octopi-cachecleaner RUNTIME DESTINATION bin LIBRARY DESTINATION lib PUBLIC_HEADER DESTINATION include)
|
||||||
|
install(FILES "${CMAKE_CURRENT_SOURCE_DIR}/octopi-cachecleaner.desktop" DESTINATION share/applications)
|
||||||
159
cachecleaner/cachecleaner.cpp
Normal file
159
cachecleaner/cachecleaner.cpp
Normal file
@@ -0,0 +1,159 @@
|
|||||||
|
/*
|
||||||
|
Copyright 2015 Michaël Lhomme
|
||||||
|
|
||||||
|
This file is part of AppSet.
|
||||||
|
|
||||||
|
AppSet is free software; you can redistribute it and/or modify
|
||||||
|
it under the terms of the GNU General Public License as published by
|
||||||
|
the Free Software Foundation; either version 2 of the License, or
|
||||||
|
(at your option) any later version.
|
||||||
|
|
||||||
|
AppSet is distributed in the hope that it will be useful,
|
||||||
|
but WITHOUT ANY WARRANTY; without even the implied warranty of
|
||||||
|
MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
|
||||||
|
GNU General Public License for more details.
|
||||||
|
|
||||||
|
You should have received a copy of the GNU General Public License
|
||||||
|
along with AppSet; if not, write to the Free Software
|
||||||
|
Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
|
||||||
|
*/
|
||||||
|
|
||||||
|
#include "cachecleaner.h"
|
||||||
|
#include "ui_cachecleaner.h"
|
||||||
|
#include "../src/strconstants.h"
|
||||||
|
|
||||||
|
#include <QKeyEvent>
|
||||||
|
#include <QTcpServer>
|
||||||
|
#include <QTcpSocket>
|
||||||
|
#include <QMessageBox>
|
||||||
|
|
||||||
|
/*
|
||||||
|
* CacheCleaner window constructor
|
||||||
|
*/
|
||||||
|
CacheCleaner::CacheCleaner(QWidget *parent) :
|
||||||
|
QMainWindow(parent),
|
||||||
|
ui(new Ui::CacheCleaner)
|
||||||
|
{
|
||||||
|
//UI initialization
|
||||||
|
ui->setupUi(this);
|
||||||
|
|
||||||
|
int keepInstalled = SettingsManager::getKeepNumInstalledPackages();
|
||||||
|
ui->keepInstalledPackagesSpinner->setValue(keepInstalled);
|
||||||
|
|
||||||
|
int keepUninstalled = SettingsManager::getKeepNumUninstalledPackages();
|
||||||
|
ui->keepUninstalledPackagesSpinner->setValue(keepUninstalled);
|
||||||
|
|
||||||
|
//create package group wrappers
|
||||||
|
m_installed = new PackageGroupModel(QLatin1String(""),
|
||||||
|
ui->installedPackagesList,
|
||||||
|
ui->keepInstalledPackagesSpinner,
|
||||||
|
ui->refreshInstalledButton,
|
||||||
|
ui->cleanInstalledButton);
|
||||||
|
|
||||||
|
m_uninstalled = new PackageGroupModel(QStringLiteral("-u"),
|
||||||
|
ui->uninstalledPackagesList,
|
||||||
|
ui->keepUninstalledPackagesSpinner,
|
||||||
|
ui->refreshUninstalledButton,
|
||||||
|
ui->cleanUninstalledButton);
|
||||||
|
|
||||||
|
m_tcpServer = new QTcpServer(this);
|
||||||
|
connect(m_tcpServer, &QTcpServer::newConnection, this, &CacheCleaner::onSendInfoToOctopiHelper);
|
||||||
|
|
||||||
|
restoreGeometry(SettingsManager::getCacheCleanerWindowSize());
|
||||||
|
}
|
||||||
|
|
||||||
|
/*
|
||||||
|
* Cache Cleaner destructor
|
||||||
|
*/
|
||||||
|
CacheCleaner::~CacheCleaner()
|
||||||
|
{
|
||||||
|
delete m_installed;
|
||||||
|
delete m_uninstalled;
|
||||||
|
delete ui;
|
||||||
|
}
|
||||||
|
|
||||||
|
/*
|
||||||
|
* Start listening for helper connections
|
||||||
|
*/
|
||||||
|
bool CacheCleaner::startServer()
|
||||||
|
{
|
||||||
|
bool res=true;
|
||||||
|
|
||||||
|
if (!m_tcpServer->listen(QHostAddress::LocalHost, 12703))
|
||||||
|
{
|
||||||
|
QMessageBox::critical(this, StrConstants::getApplicationName(),
|
||||||
|
QStringLiteral("Unable to start the server: %1.")
|
||||||
|
.arg(m_tcpServer->errorString()));
|
||||||
|
res=false;
|
||||||
|
}
|
||||||
|
|
||||||
|
return res;
|
||||||
|
}
|
||||||
|
|
||||||
|
/*
|
||||||
|
* Answers Helper if CacheCleaner is executing actions
|
||||||
|
*/
|
||||||
|
void CacheCleaner::onSendInfoToOctopiHelper()
|
||||||
|
{
|
||||||
|
QString msg;
|
||||||
|
QByteArray block;
|
||||||
|
QDataStream out(&block, QIODevice::WriteOnly);
|
||||||
|
out.setVersion(QDataStream::Qt_5_15);
|
||||||
|
|
||||||
|
//Is octopi-helper running?
|
||||||
|
bool isHelperExecuting=UnixCommand::isOctopiHelperRunning();
|
||||||
|
|
||||||
|
bool commandExecuting = (m_installed->isExecutingCommand || m_uninstalled->isExecutingCommand);
|
||||||
|
|
||||||
|
if (isHelperExecuting && commandExecuting)
|
||||||
|
{
|
||||||
|
msg=QLatin1String("Octopi est occupatus");
|
||||||
|
out << msg;
|
||||||
|
}
|
||||||
|
else if (isHelperExecuting && !commandExecuting)
|
||||||
|
{
|
||||||
|
msg=QLatin1String("Octopi serenum est");
|
||||||
|
out << msg;
|
||||||
|
}
|
||||||
|
else
|
||||||
|
{
|
||||||
|
msg=QLatin1String("Atramento nigro");
|
||||||
|
out << msg;
|
||||||
|
}
|
||||||
|
|
||||||
|
QTcpSocket *clientConnection = m_tcpServer->nextPendingConnection();
|
||||||
|
if (clientConnection->isOpen())
|
||||||
|
{
|
||||||
|
connect(clientConnection, &QAbstractSocket::disconnected,
|
||||||
|
clientConnection, &QObject::deleteLater);
|
||||||
|
|
||||||
|
clientConnection->write(block);
|
||||||
|
clientConnection->disconnectFromHost();
|
||||||
|
}
|
||||||
|
|
||||||
|
//m_installed->isExecutingCommand=false;
|
||||||
|
//m_uninstalled->isExecutingCommand=false;
|
||||||
|
}
|
||||||
|
|
||||||
|
/*
|
||||||
|
* Save settings when closing window
|
||||||
|
*/
|
||||||
|
void CacheCleaner::closeEvent(QCloseEvent *)
|
||||||
|
{
|
||||||
|
QByteArray windowSize=saveGeometry();
|
||||||
|
|
||||||
|
SettingsManager::setCacheCleanerWindowSize(windowSize);
|
||||||
|
SettingsManager::setKeepNumInstalledPackages(ui->keepInstalledPackagesSpinner->value());
|
||||||
|
SettingsManager::setKeepNumUninstalledPackages(ui->keepUninstalledPackagesSpinner->value());
|
||||||
|
}
|
||||||
|
|
||||||
|
/*
|
||||||
|
* Whenever user presses ESC, we quit the program
|
||||||
|
*/
|
||||||
|
void CacheCleaner::keyPressEvent(QKeyEvent *ke)
|
||||||
|
{
|
||||||
|
if (ke->key() == Qt::Key_Escape)
|
||||||
|
{
|
||||||
|
close();
|
||||||
|
}
|
||||||
|
}
|
||||||
60
cachecleaner/cachecleaner.h
Normal file
60
cachecleaner/cachecleaner.h
Normal file
@@ -0,0 +1,60 @@
|
|||||||
|
/*
|
||||||
|
Copyright 2015 Michaël Lhomme
|
||||||
|
|
||||||
|
This file is part of AppSet.
|
||||||
|
|
||||||
|
AppSet is free software; you can redistribute it and/or modify
|
||||||
|
it under the terms of the GNU General Public License as published by
|
||||||
|
the Free Software Foundation; either version 2 of the License, or
|
||||||
|
(at your option) any later version.
|
||||||
|
|
||||||
|
AppSet is distributed in the hope that it will be useful,
|
||||||
|
but WITHOUT ANY WARRANTY; without even the implied warranty of
|
||||||
|
MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
|
||||||
|
GNU General Public License for more details.
|
||||||
|
|
||||||
|
You should have received a copy of the GNU General Public License
|
||||||
|
along with AppSet; if not, write to the Free Software
|
||||||
|
Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
|
||||||
|
*/
|
||||||
|
|
||||||
|
#ifndef CACHECLEANER_H
|
||||||
|
#define CACHECLEANER_H
|
||||||
|
|
||||||
|
#include <QMainWindow>
|
||||||
|
|
||||||
|
#include "packagegroupmodel.h"
|
||||||
|
|
||||||
|
class QTcpServer;
|
||||||
|
|
||||||
|
namespace Ui {
|
||||||
|
class CacheCleaner;
|
||||||
|
}
|
||||||
|
|
||||||
|
/*
|
||||||
|
* Main CacheCleaner window
|
||||||
|
*/
|
||||||
|
class CacheCleaner : public QMainWindow
|
||||||
|
{
|
||||||
|
Q_OBJECT
|
||||||
|
|
||||||
|
private:
|
||||||
|
Ui::CacheCleaner *ui;
|
||||||
|
PackageGroupModel *m_installed;
|
||||||
|
PackageGroupModel *m_uninstalled;
|
||||||
|
QTcpServer *m_tcpServer;
|
||||||
|
|
||||||
|
private slots:
|
||||||
|
void onSendInfoToOctopiHelper();
|
||||||
|
|
||||||
|
public:
|
||||||
|
explicit CacheCleaner(QWidget *parent = 0);
|
||||||
|
~CacheCleaner();
|
||||||
|
bool startServer();
|
||||||
|
|
||||||
|
protected:
|
||||||
|
void closeEvent(QCloseEvent *);
|
||||||
|
void keyPressEvent(QKeyEvent *);
|
||||||
|
};
|
||||||
|
|
||||||
|
#endif // CACHECLEANER_H
|
||||||
94
cachecleaner/main.cpp
Normal file
94
cachecleaner/main.cpp
Normal file
@@ -0,0 +1,94 @@
|
|||||||
|
/*
|
||||||
|
Copyright 2015 Michaël Lhomme
|
||||||
|
|
||||||
|
This file is part of AppSet.
|
||||||
|
|
||||||
|
AppSet is free software; you can redistribute it and/or modify
|
||||||
|
it under the terms of the GNU General Public License as published by
|
||||||
|
the Free Software Foundation; either version 2 of the License, or
|
||||||
|
(at your option) any later version.
|
||||||
|
|
||||||
|
AppSet is distributed in the hope that it will be useful,
|
||||||
|
but WITHOUT ANY WARRANTY; without even the implied warranty of
|
||||||
|
MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
|
||||||
|
GNU General Public License for more details.
|
||||||
|
|
||||||
|
You should have received a copy of the GNU General Public License
|
||||||
|
along with AppSet; if not, write to the Free Software
|
||||||
|
Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
|
||||||
|
*/
|
||||||
|
|
||||||
|
#include "cachecleaner.h"
|
||||||
|
#include "../src/strconstants.h"
|
||||||
|
#include "../src/QtSolutions/qtsingleapplication.h"
|
||||||
|
|
||||||
|
#include <QApplication>
|
||||||
|
#include <QMessageBox>
|
||||||
|
#include <QTranslator>
|
||||||
|
#include <QLocale>
|
||||||
|
#include <QLibraryInfo>
|
||||||
|
#include <QtGui>
|
||||||
|
|
||||||
|
int main( int argc, char *argv[] )
|
||||||
|
{
|
||||||
|
unsetenv("TMPDIR");
|
||||||
|
QtSingleApplication app( QStringLiteral("Cache Cleaner - Octopi"), argc, argv );
|
||||||
|
|
||||||
|
//If there is already an instance running...
|
||||||
|
if (app.isRunning())
|
||||||
|
{
|
||||||
|
app.sendMessage(QStringLiteral("RAISE"));
|
||||||
|
return 0;
|
||||||
|
}
|
||||||
|
|
||||||
|
app.sendMessage(QStringLiteral("RAISE"));
|
||||||
|
|
||||||
|
QTranslator appTranslator;
|
||||||
|
bool success = appTranslator.load(QLatin1String(":/resources/translations/octopi_cachecleaner_") +
|
||||||
|
QLocale::system().name());
|
||||||
|
if (!success)
|
||||||
|
{
|
||||||
|
success = appTranslator.load(QStringLiteral(":/resources/translations/octopi_cachecleaner_en.qm"));
|
||||||
|
}
|
||||||
|
|
||||||
|
app.installTranslator(&appTranslator);
|
||||||
|
|
||||||
|
if (UnixCommand::isRootRunning()){
|
||||||
|
QMessageBox::critical( nullptr, StrConstants::getApplicationName(), StrConstants::getErrorRunningWithRoot());
|
||||||
|
return (-2);
|
||||||
|
}
|
||||||
|
|
||||||
|
if (!UnixCommand::hasTheExecutable(QStringLiteral("paccache")))
|
||||||
|
{
|
||||||
|
QMessageBox::critical( nullptr, StrConstants::getApplicationName(), StrConstants::getExecutableCouldNotBeFound().arg(QStringLiteral("\"paccache\"")));
|
||||||
|
return (-3);
|
||||||
|
}
|
||||||
|
|
||||||
|
if (!QFile::exists(ctn_OCTOPI_HELPER_PATH))
|
||||||
|
{
|
||||||
|
qDebug() << "Aborting cache-cleaner as 'octphelper' binary could not be found! [" << ctn_OCTOPI_HELPER_PATH << "]";
|
||||||
|
return (-4);
|
||||||
|
}
|
||||||
|
|
||||||
|
if (!QFile::exists(ctn_OCTOPISUDO))
|
||||||
|
{
|
||||||
|
qDebug() << "Aborting cache-cleaner as 'octopi-sudo' binary could not be found! [" << ctn_OCTOPISUDO << "]";
|
||||||
|
return (-5);
|
||||||
|
}
|
||||||
|
|
||||||
|
if (!UnixCommand::isOctoToolRunning(QStringLiteral("octopi-cachecleaner")))
|
||||||
|
{
|
||||||
|
QMessageBox::critical(nullptr, StrConstants::getApplicationName(), StrConstants::getErrorRunOctopiCacheCleanerAsUsrBin());
|
||||||
|
return (-6);
|
||||||
|
}
|
||||||
|
|
||||||
|
CacheCleaner w;
|
||||||
|
if (w.startServer())
|
||||||
|
{
|
||||||
|
app.setActivationWindow(&w);
|
||||||
|
w.show();
|
||||||
|
QResource::registerResource(QStringLiteral("./resources.qrc"));
|
||||||
|
|
||||||
|
return app.exec();
|
||||||
|
}
|
||||||
|
}
|
||||||
11
cachecleaner/octopi-cachecleaner.desktop
Normal file
11
cachecleaner/octopi-cachecleaner.desktop
Normal file
@@ -0,0 +1,11 @@
|
|||||||
|
[Desktop Entry]
|
||||||
|
Name=Octopi CacheCleaner
|
||||||
|
Icon=octopi
|
||||||
|
Exec=/usr/bin/octopi-cachecleaner
|
||||||
|
Terminal=false
|
||||||
|
Type=Application
|
||||||
|
Categories=GNOME;GTK;System;
|
||||||
|
#NotShowIn=GNOME;XFCE;LXDE;KDE;
|
||||||
|
StartupNotify=true
|
||||||
|
Version=1.5
|
||||||
|
SingleMainWindow=true
|
||||||
132
cachecleaner/octopi-cachecleaner.pro
Normal file
132
cachecleaner/octopi-cachecleaner.pro
Normal file
@@ -0,0 +1,132 @@
|
|||||||
|
#-------------------------------------------------
|
||||||
|
#
|
||||||
|
# Project created by QtCreator 2013-02-21T18:57:08
|
||||||
|
#
|
||||||
|
#-------------------------------------------------
|
||||||
|
|
||||||
|
QT += core gui network xml widgets
|
||||||
|
|
||||||
|
CONFIG += qt console warn_on debug
|
||||||
|
|
||||||
|
# Disable automatic string conversions
|
||||||
|
DEFINES += QT_USE_QSTRINGBUILDER \
|
||||||
|
QT_NO_CAST_FROM_ASCII \
|
||||||
|
QT_NO_CAST_TO_ASCII \
|
||||||
|
QT_NO_URL_CAST_FROM_STRING \
|
||||||
|
QT_NO_CAST_FROM_BYTEARRAY
|
||||||
|
|
||||||
|
TEMPLATE = app
|
||||||
|
DESTDIR += bin
|
||||||
|
OBJECTS_DIR += build
|
||||||
|
MOC_DIR += build
|
||||||
|
UI_DIR += build
|
||||||
|
|
||||||
|
HEADERS += cachecleaner.h \
|
||||||
|
packagegroupmodel.h \
|
||||||
|
../src/strconstants.h \
|
||||||
|
../src/qaesencryption.h \
|
||||||
|
../src/unixcommand.h \
|
||||||
|
../src/wmhelper.h \
|
||||||
|
../src/terminal.h \
|
||||||
|
../src/settingsmanager.h \
|
||||||
|
../src/searchlineedit.h \
|
||||||
|
../src/utils.h \
|
||||||
|
../src/package.h \
|
||||||
|
../src/QtSolutions/qtsingleapplication.h \
|
||||||
|
../src/QtSolutions/qtlocalpeer.h \
|
||||||
|
../src/QtSolutions/qtlockedfile.h \
|
||||||
|
../src/QtSolutions/qtsinglecoreapplication.h
|
||||||
|
|
||||||
|
|
||||||
|
SOURCES += main.cpp \
|
||||||
|
cachecleaner.cpp \
|
||||||
|
packagegroupmodel.cpp \
|
||||||
|
../src/strconstants.cpp \
|
||||||
|
../src/qaesencryption.cpp \
|
||||||
|
../src/unixcommand.cpp \
|
||||||
|
../src/wmhelper.cpp \
|
||||||
|
../src/terminal.cpp \
|
||||||
|
../src/settingsmanager.cpp \
|
||||||
|
../src/searchlineedit.cpp \
|
||||||
|
../src/utils.cpp \
|
||||||
|
../src/package.cpp \
|
||||||
|
../src/QtSolutions/qtsingleapplication.cpp \
|
||||||
|
../src/QtSolutions/qtlocalpeer.cpp \
|
||||||
|
../src/QtSolutions/qtlockedfile.cpp \
|
||||||
|
../src/QtSolutions/qtsinglecoreapplication.cpp
|
||||||
|
|
||||||
|
FORMS += ui/cachecleaner.ui
|
||||||
|
|
||||||
|
RESOURCES += resources.qrc
|
||||||
|
|
||||||
|
TRANSLATIONS += resources/translations/octopi_cachecleaner_pt_BR.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_fr_FR.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_fr.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_es_ES.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_es_419.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_es_AR.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_el.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_de.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_it.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_ro.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_tr_TR.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_ar.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_ca.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_bg.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_pl.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_id.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_da.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_cs.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_he.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_hi.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_hi_IN.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_lt.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_nb.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_sr@latin.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_sr_RS.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_nl.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_ru.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_uz.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_fi.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_fi_FI.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_vi.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_en_GB.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_pt_PT.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_sv.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_sl.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_hu.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_zh_TW.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_ms_MY.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_uk.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_sk.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_ja.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_eu.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_gl_ES.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_ast.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_hr.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_zh-Hans.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_zh_CN.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_ko.ts \
|
||||||
|
resources/translations/octopi_cachecleaner_ko_KR.ts \
|
||||||
|
|
||||||
|
# install
|
||||||
|
isEmpty(PREFIX) {
|
||||||
|
PREFIX = /usr
|
||||||
|
}
|
||||||
|
|
||||||
|
isEmpty(BINDIR) {
|
||||||
|
BINDIR = $$PREFIX/bin
|
||||||
|
}
|
||||||
|
|
||||||
|
isEmpty(DATADIR) {
|
||||||
|
DATADIR = $$PREFIX/share
|
||||||
|
}
|
||||||
|
|
||||||
|
target.path = $$BINDIR
|
||||||
|
sources.files = $$SOURCES $$HEADERS $$RESOURCES $$FORMS *.pro
|
||||||
|
sources.path = .
|
||||||
|
|
||||||
|
desktop.path = $$DATADIR/applications
|
||||||
|
desktop.files += cachecleaner/octopi-cachecleaner.desktop
|
||||||
|
|
||||||
|
INSTALLS += target desktop
|
||||||
283
cachecleaner/packagegroupmodel.cpp
Normal file
283
cachecleaner/packagegroupmodel.cpp
Normal file
@@ -0,0 +1,283 @@
|
|||||||
|
/*
|
||||||
|
Copyright 2015 Michaël Lhomme
|
||||||
|
|
||||||
|
This file is part of AppSet.
|
||||||
|
|
||||||
|
AppSet is free software; you can redistribute it and/or modify
|
||||||
|
it under the terms of the GNU General Public License as published by
|
||||||
|
the Free Software Foundation; either version 2 of the License, or
|
||||||
|
(at your option) any later version.
|
||||||
|
|
||||||
|
AppSet is distributed in the hope that it will be useful,
|
||||||
|
but WITHOUT ANY WARRANTY; without even the implied warranty of
|
||||||
|
MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
|
||||||
|
GNU General Public License for more details.
|
||||||
|
|
||||||
|
You should have received a copy of the GNU General Public License
|
||||||
|
along with AppSet; if not, write to the Free Software
|
||||||
|
Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
|
||||||
|
*/
|
||||||
|
|
||||||
|
#include "packagegroupmodel.h"
|
||||||
|
#include "../src/strconstants.h"
|
||||||
|
|
||||||
|
#include <QSharedMemory>
|
||||||
|
#include <QApplication>
|
||||||
|
#include <QMessageBox>
|
||||||
|
|
||||||
|
/*
|
||||||
|
* Constructor
|
||||||
|
*
|
||||||
|
* @param listView The list view to display packages
|
||||||
|
* @param spinner The spinner to configure the number of archive to keep
|
||||||
|
* @param refreshBtn The refresh view button
|
||||||
|
* @param cleanBtn The clean button
|
||||||
|
*/
|
||||||
|
PackageGroupModel::PackageGroupModel(QString optionsString,
|
||||||
|
QListWidget *listView,
|
||||||
|
QSpinBox *spinner,
|
||||||
|
QPushButton *refreshBtn,
|
||||||
|
QPushButton *cleanBtn)
|
||||||
|
: QObject(nullptr),
|
||||||
|
m_optionsString(optionsString),
|
||||||
|
m_listView(listView),
|
||||||
|
m_spinner(spinner),
|
||||||
|
m_refreshButton(refreshBtn),
|
||||||
|
m_cleanButton(cleanBtn),
|
||||||
|
m_cmd(new UnixCommand(this)),
|
||||||
|
m_acc(new ProcessOutputAccumulator(m_cmd)),
|
||||||
|
m_oldKeepValue(spinner->value())
|
||||||
|
{
|
||||||
|
m_cleanButton->setText(tr("Clean"));
|
||||||
|
|
||||||
|
m_sharedMemory=new QSharedMemory(QStringLiteral("org.arnt.octopi"), this);
|
||||||
|
|
||||||
|
//setup UI slots
|
||||||
|
connect( m_spinner, SIGNAL( valueChanged(int) ), SLOT( updateKeepArchives() ) );
|
||||||
|
connect( m_spinner, SIGNAL( valueChanged(int) ), SLOT( refreshCacheView() ) );
|
||||||
|
connect( m_spinner, SIGNAL( editingFinished() ), SLOT( keepArchivesChanged() ) );
|
||||||
|
connect( m_refreshButton, SIGNAL( clicked() ), SLOT( refreshCacheView() ) );
|
||||||
|
connect( m_cleanButton, SIGNAL( clicked() ), SLOT( cleanCache() ) );
|
||||||
|
|
||||||
|
isExecutingCommand = false;
|
||||||
|
|
||||||
|
//refresh cache informations at startup
|
||||||
|
refreshCacheView();
|
||||||
|
}
|
||||||
|
|
||||||
|
/*
|
||||||
|
* Destructor
|
||||||
|
*/
|
||||||
|
PackageGroupModel::~PackageGroupModel()
|
||||||
|
{
|
||||||
|
//UnixCommand::removeSharedMemFiles();
|
||||||
|
delete m_acc;
|
||||||
|
delete m_cmd;
|
||||||
|
}
|
||||||
|
|
||||||
|
/*
|
||||||
|
* Handle spinner change: disable the clean button
|
||||||
|
* to ensure consistency between the list and what
|
||||||
|
* will effectively be cleared if the user press
|
||||||
|
* the button
|
||||||
|
*/
|
||||||
|
void PackageGroupModel::updateKeepArchives()
|
||||||
|
{
|
||||||
|
m_cleanButton->setEnabled(false);
|
||||||
|
}
|
||||||
|
|
||||||
|
/*
|
||||||
|
* Refresh the cache when the spinner change are validated
|
||||||
|
*/
|
||||||
|
void PackageGroupModel::keepArchivesChanged()
|
||||||
|
{
|
||||||
|
if(m_spinner->value() != m_oldKeepValue)
|
||||||
|
refreshCacheView();
|
||||||
|
}
|
||||||
|
|
||||||
|
/*
|
||||||
|
* Return the options to pass to paccache according to the current context
|
||||||
|
*/
|
||||||
|
QString PackageGroupModel::getOptions()
|
||||||
|
{
|
||||||
|
return QStringLiteral("%1-k %2").arg(m_optionsString).arg(m_spinner->value());
|
||||||
|
}
|
||||||
|
|
||||||
|
/*
|
||||||
|
* Refresh the view
|
||||||
|
*/
|
||||||
|
void PackageGroupModel::refreshCacheView()
|
||||||
|
{
|
||||||
|
if (isExecutingCommand) return;
|
||||||
|
|
||||||
|
//update UI for background refresh
|
||||||
|
QApplication::setOverrideCursor(Qt::WaitCursor);
|
||||||
|
m_acc->reset();
|
||||||
|
m_refreshButton->setEnabled(false);
|
||||||
|
m_cleanButton->setEnabled(false);
|
||||||
|
m_listView->clear();
|
||||||
|
|
||||||
|
m_oldKeepValue = m_spinner->value();
|
||||||
|
|
||||||
|
//connect handler slot and call the command
|
||||||
|
QObject::connect(m_cmd, SIGNAL( finished ( int, QProcess::ExitStatus )),
|
||||||
|
this, SLOT( finishedDryrun ( int, QProcess::ExitStatus )) );
|
||||||
|
|
||||||
|
QStringList sl;
|
||||||
|
sl << QStringLiteral("-v");
|
||||||
|
sl << QStringLiteral("-d");
|
||||||
|
QStringList opt = getOptions().split(QStringLiteral(" "), Qt::SkipEmptyParts);
|
||||||
|
sl << opt;
|
||||||
|
m_cmd->executeCommandAsNormalUser(QStringLiteral("/usr/bin/paccache"), sl);
|
||||||
|
isExecutingCommand = true;
|
||||||
|
}
|
||||||
|
|
||||||
|
/*
|
||||||
|
* Checks if some SU utility is available...
|
||||||
|
* Returns false if not!
|
||||||
|
*/
|
||||||
|
bool PackageGroupModel::isSUAvailable()
|
||||||
|
{
|
||||||
|
//If there are no means to run the actions, we must warn!
|
||||||
|
if (UnixCommand::isRootRunning() && WMHelper::isKDERunning())
|
||||||
|
{
|
||||||
|
return true;
|
||||||
|
}
|
||||||
|
else if (WMHelper::getSUCommand() == ctn_NO_SU_COMMAND){
|
||||||
|
QMessageBox::critical( nullptr, StrConstants::getApplicationName(),
|
||||||
|
StrConstants::getErrorNoSuCommand() +
|
||||||
|
QLatin1String("\n") + StrConstants::getYoullNeedSuFrontend());
|
||||||
|
return false;
|
||||||
|
}
|
||||||
|
else
|
||||||
|
return true;
|
||||||
|
}
|
||||||
|
|
||||||
|
/*
|
||||||
|
* Call paccache to effectively clear the cache
|
||||||
|
*/
|
||||||
|
void PackageGroupModel::cleanCache()
|
||||||
|
{
|
||||||
|
if (isExecutingCommand || UnixCommand::isPacmanDbLocked()){
|
||||||
|
QMessageBox::critical( nullptr, StrConstants::getApplicationName(),
|
||||||
|
StrConstants::getErrorDbLock());
|
||||||
|
return;
|
||||||
|
}
|
||||||
|
|
||||||
|
if (!isSUAvailable())
|
||||||
|
return;
|
||||||
|
|
||||||
|
//update UI buttons
|
||||||
|
QApplication::setOverrideCursor(Qt::WaitCursor);
|
||||||
|
m_acc->reset();
|
||||||
|
m_refreshButton->setEnabled(false);
|
||||||
|
m_cleanButton->setEnabled(false);
|
||||||
|
|
||||||
|
//connect handler slot and call the command
|
||||||
|
QObject::connect(m_cmd, SIGNAL( finished ( int, QProcess::ExitStatus )),
|
||||||
|
this, SLOT( finishedClean( int, QProcess::ExitStatus )) );
|
||||||
|
|
||||||
|
isExecutingCommand = true;
|
||||||
|
const QString tmp = QLatin1String("paccache -r ") + getOptions();
|
||||||
|
//UnixCommand::removeTemporaryFiles();
|
||||||
|
m_cmd->executeCommandWithSharedMemHelper(tmp, m_sharedMemory);
|
||||||
|
}
|
||||||
|
|
||||||
|
/*
|
||||||
|
* Handle the result of the refresh action
|
||||||
|
*/
|
||||||
|
void PackageGroupModel::finishedDryrun(int exitCode, QProcess::ExitStatus)
|
||||||
|
{
|
||||||
|
//disconnect the handler
|
||||||
|
QObject::disconnect(m_cmd, SIGNAL( finished ( int, QProcess::ExitStatus )),
|
||||||
|
this, SLOT( finishedDryrun ( int, QProcess::ExitStatus )) );
|
||||||
|
|
||||||
|
QApplication::restoreOverrideCursor();
|
||||||
|
|
||||||
|
isExecutingCommand = false;
|
||||||
|
|
||||||
|
if(exitCode > 1)
|
||||||
|
{
|
||||||
|
//process failed, provide info on errors
|
||||||
|
QMessageBox::critical(m_listView, QStringLiteral("Error with the underlying process"), m_acc->getErrors());
|
||||||
|
}
|
||||||
|
else if (exitCode == 0)
|
||||||
|
{
|
||||||
|
//process finished successfully, process the resulting output
|
||||||
|
processDryrunResult(m_acc->getOutput());
|
||||||
|
}
|
||||||
|
|
||||||
|
//in either case, reenable the refresh button
|
||||||
|
m_refreshButton->setEnabled(true);
|
||||||
|
}
|
||||||
|
|
||||||
|
/*
|
||||||
|
* Handle the result of the clean action
|
||||||
|
*/
|
||||||
|
void PackageGroupModel::finishedClean(int exitCode, QProcess::ExitStatus)
|
||||||
|
{
|
||||||
|
//disconnect the handler
|
||||||
|
QObject::disconnect(m_cmd, SIGNAL( finished ( int, QProcess::ExitStatus ) ),
|
||||||
|
this, SLOT( finishedClean(int, QProcess::ExitStatus ) ) );
|
||||||
|
|
||||||
|
QApplication::restoreOverrideCursor();
|
||||||
|
|
||||||
|
isExecutingCommand = false;
|
||||||
|
|
||||||
|
if(exitCode != 0)
|
||||||
|
{
|
||||||
|
//process failed, return to main window
|
||||||
|
m_refreshButton->setEnabled(true);
|
||||||
|
m_cleanButton->setEnabled(true);
|
||||||
|
}
|
||||||
|
else
|
||||||
|
{
|
||||||
|
//refresh the view
|
||||||
|
refreshCacheView();
|
||||||
|
}
|
||||||
|
}
|
||||||
|
|
||||||
|
/*
|
||||||
|
* Process the output of the refresh commands
|
||||||
|
*
|
||||||
|
* @param output The output of the dryrun process
|
||||||
|
*/
|
||||||
|
void PackageGroupModel::processDryrunResult(QString output) {
|
||||||
|
QStringList lines = output.split(QRegularExpression(QStringLiteral("\\n")), Qt::SkipEmptyParts);
|
||||||
|
|
||||||
|
if(lines.length() == 1 || output.contains(QLatin1String("*.pkg.tar?(.+([^.]))")))
|
||||||
|
{
|
||||||
|
//"==> no candidate packages found for pruning"
|
||||||
|
m_cleanButton->setText(tr("Clean"));
|
||||||
|
}
|
||||||
|
else
|
||||||
|
{
|
||||||
|
//process package list
|
||||||
|
for(int i = 0; i < lines.length(); i++)
|
||||||
|
{
|
||||||
|
const QString& line = lines.at(i);
|
||||||
|
|
||||||
|
if(i == 0)
|
||||||
|
//skip the first line ("==> Candidate packages:")
|
||||||
|
continue;
|
||||||
|
|
||||||
|
else if(i == lines.length() - 1)
|
||||||
|
{
|
||||||
|
//extract size from "==> finished dry run: 8 candidates (disk space saved: 19.11 MiB)")
|
||||||
|
QStringList components = line.split(QStringLiteral(" "));
|
||||||
|
|
||||||
|
QString unit = components.takeLast();
|
||||||
|
unit.remove(unit.length() - 1, 1);
|
||||||
|
|
||||||
|
QString size = components.takeLast();
|
||||||
|
|
||||||
|
m_cleanButton->setText(tr("Clean %1").arg(QLatin1Char(' ') + size + QLatin1Char(' ') + unit));
|
||||||
|
}
|
||||||
|
else
|
||||||
|
m_listView->addItem(line);
|
||||||
|
}
|
||||||
|
|
||||||
|
//there is packages to clean so reenable the clean button
|
||||||
|
m_cleanButton->setEnabled(true);
|
||||||
|
}
|
||||||
|
}
|
||||||
114
cachecleaner/packagegroupmodel.h
Normal file
114
cachecleaner/packagegroupmodel.h
Normal file
@@ -0,0 +1,114 @@
|
|||||||
|
/*
|
||||||
|
Copyright 2015 Michaël Lhomme
|
||||||
|
|
||||||
|
This file is part of AppSet.
|
||||||
|
|
||||||
|
AppSet is free software; you can redistribute it and/or modify
|
||||||
|
it under the terms of the GNU General Public License as published by
|
||||||
|
the Free Software Foundation; either version 2 of the License, or
|
||||||
|
(at your option) any later version.
|
||||||
|
|
||||||
|
AppSet is distributed in the hope that it will be useful,
|
||||||
|
but WITHOUT ANY WARRANTY; without even the implied warranty of
|
||||||
|
MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
|
||||||
|
GNU General Public License for more details.
|
||||||
|
|
||||||
|
You should have received a copy of the GNU General Public License
|
||||||
|
along with AppSet; if not, write to the Free Software
|
||||||
|
Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
|
||||||
|
*/
|
||||||
|
|
||||||
|
#ifndef PACKAGEGROUP_H
|
||||||
|
#define PACKAGEGROUP_H
|
||||||
|
|
||||||
|
#include <QObject>
|
||||||
|
#include <QSpinBox>
|
||||||
|
#include <QListWidget>
|
||||||
|
#include <QPushButton>
|
||||||
|
|
||||||
|
#include "../src/unixcommand.h"
|
||||||
|
#include "../src/wmhelper.h"
|
||||||
|
|
||||||
|
/*
|
||||||
|
* Helper class to accumulate UnixCommand standard and error output
|
||||||
|
* on the fly
|
||||||
|
*/
|
||||||
|
class ProcessOutputAccumulator : QObject
|
||||||
|
{
|
||||||
|
Q_OBJECT
|
||||||
|
|
||||||
|
public:
|
||||||
|
ProcessOutputAccumulator(UnixCommand *cmd) {
|
||||||
|
m_unixCommand = cmd;
|
||||||
|
|
||||||
|
//connect(m_unixCommand, SIGNAL( started() ), SLOT( reset() ) );
|
||||||
|
connect(m_unixCommand, SIGNAL( readyReadStandardOutput() ), SLOT( standardOutputAvailable() ) );
|
||||||
|
connect(m_unixCommand, SIGNAL( readyReadStandardError() ), SLOT( errorsOutputAvailable() ) );
|
||||||
|
}
|
||||||
|
|
||||||
|
QString getOutput() { return m_standardOutput; }
|
||||||
|
QString getErrors() { return m_errorsOutput; }
|
||||||
|
|
||||||
|
public slots:
|
||||||
|
|
||||||
|
void reset()
|
||||||
|
{
|
||||||
|
m_standardOutput.clear();
|
||||||
|
m_errorsOutput.clear();
|
||||||
|
}
|
||||||
|
|
||||||
|
void standardOutputAvailable()
|
||||||
|
{
|
||||||
|
m_standardOutput.append(m_unixCommand->readAllStandardOutput());
|
||||||
|
}
|
||||||
|
|
||||||
|
void errorsOutputAvailable()
|
||||||
|
{
|
||||||
|
m_errorsOutput.append(m_unixCommand->readAllStandardError());
|
||||||
|
}
|
||||||
|
|
||||||
|
protected:
|
||||||
|
UnixCommand *m_unixCommand;
|
||||||
|
QString m_standardOutput;
|
||||||
|
QString m_errorsOutput;
|
||||||
|
};
|
||||||
|
|
||||||
|
/*
|
||||||
|
* Wrapper to encapsulate operation on package groups (installed and uninstalled)
|
||||||
|
*/
|
||||||
|
class PackageGroupModel : public QObject
|
||||||
|
{
|
||||||
|
Q_OBJECT
|
||||||
|
|
||||||
|
private:
|
||||||
|
bool isSUAvailable();
|
||||||
|
QSharedMemory *m_sharedMemory;
|
||||||
|
|
||||||
|
public:
|
||||||
|
PackageGroupModel(QString, QListWidget *, QSpinBox *, QPushButton *, QPushButton *);
|
||||||
|
~PackageGroupModel();
|
||||||
|
bool isExecutingCommand;
|
||||||
|
|
||||||
|
protected:
|
||||||
|
QString m_optionsString;
|
||||||
|
QListWidget *m_listView;
|
||||||
|
QSpinBox *m_spinner;
|
||||||
|
QPushButton *m_refreshButton;
|
||||||
|
QPushButton *m_cleanButton;
|
||||||
|
UnixCommand *m_cmd;
|
||||||
|
ProcessOutputAccumulator *m_acc;
|
||||||
|
int m_oldKeepValue;
|
||||||
|
|
||||||
|
void processDryrunResult(QString);
|
||||||
|
QString getOptions();
|
||||||
|
|
||||||
|
public slots:
|
||||||
|
void refreshCacheView();
|
||||||
|
void cleanCache();
|
||||||
|
void updateKeepArchives();
|
||||||
|
void keepArchivesChanged();
|
||||||
|
void finishedDryrun(int, QProcess::ExitStatus);
|
||||||
|
void finishedClean(int, QProcess::ExitStatus);
|
||||||
|
};
|
||||||
|
|
||||||
|
#endif // PACKAGEGROUP_H
|
||||||
54
cachecleaner/resources.qrc
Normal file
54
cachecleaner/resources.qrc
Normal file
@@ -0,0 +1,54 @@
|
|||||||
|
<RCC>
|
||||||
|
<qresource prefix="/">
|
||||||
|
<file>resources/images/cachecleaner.png</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_ar.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_ast.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_bg.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_ca.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_cs.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_da.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_de.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_el.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_en_GB.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_en.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_es_419.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_es_AR.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_es_ES.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_eu.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_fi.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_fi_FI.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_fr_FR.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_fr.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_he.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_hi.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_hi_IN.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_hu.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_id.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_it.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_ja.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_lt.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_ms_MY.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_nb.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_nl.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_pl.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_pt_BR.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_pt_PT.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_ro.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_ru.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_sk.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_sr@latin.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_sr_RS.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_sv.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_sl.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_tr_TR.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_tr.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_uk.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_uz.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_vi.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_zh_TW.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_zh-Hans.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_zh_CN.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_hr.qm</file>
|
||||||
|
<file>resources/translations/octopi_cachecleaner_ko.qm</file>
|
||||||
|
</qresource>
|
||||||
|
</RCC>
|
||||||
BIN
cachecleaner/resources/images/cachecleaner.png
Normal file
BIN
cachecleaner/resources/images/cachecleaner.png
Normal file
Binary file not shown.
|
After Width: | Height: | Size: 827 B |
BIN
cachecleaner/resources/images/octopi_green.png
Normal file
BIN
cachecleaner/resources/images/octopi_green.png
Normal file
Binary file not shown.
|
After Width: | Height: | Size: 1.2 KiB |
BIN
cachecleaner/resources/images/octopi_red.png
Normal file
BIN
cachecleaner/resources/images/octopi_red.png
Normal file
Binary file not shown.
|
After Width: | Height: | Size: 1.2 KiB |
BIN
cachecleaner/resources/translations/octopi_cachecleaner_af.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_af.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="af" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_af_ZA.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_af_ZA.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="af_ZA" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_ar.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_ar.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="ar" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation>منظف الكاش - Octopi</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation>حزم غير مثبتة</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation>إحتفظ:</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation>عدد النُسخ القديمة للإبقاء عليها</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation>تحديث</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation>حزم مثبتة</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation>مسح</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation>إمسح %1</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_ast.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_ast.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="ast" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation>Llimpiador de la caché - Octopi</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation>Paquetes desinstalaos</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation>Caltener:</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation>Númberu de versiones vieyes a caltener</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation>Refrescar</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation>Paquetes instalaos</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation>Llimpiar</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation>Llimpiar %1</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_be.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_be.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="be" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_be_BY.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_be_BY.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="be_BY" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_bg.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_bg.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="bg" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation>Почистване на кеша - „Octopi“</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation>Премахнати пакети</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation>Запази :</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation>Брой на старите версии за запазване</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation>Опресняване</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation>Инсталирани пакети</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation>Почистване</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation>Почистване на %1</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_bs.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_bs.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="bs" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_bs_BA.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_bs_BA.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="bs_BA" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation>Keš čistač - Octopi</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation>Deinstalirani paketi</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation>Zadrži</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation>Zadržati broj starih verzija</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation>Osvježi</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation>Instalirani paketi</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation>Očisti</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation>Očisti %1</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_ca.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_ca.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="ca" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation>Netejador de la cau - Octopi</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation>Paquets desinstal·lats</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation>Mantén:</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation>Quantitat de versions antigues a mantenir:</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation>Refresca</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation>Paquets instal·lats</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation>Neteja</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation>Neteja %1</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_cmn.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_cmn.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="cmn" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_cs.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_cs.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="cs" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation>Čistič vyrovnávací paměti</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation>Odinstalované balíčky</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation>Zachovat :</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation>Počet starých verzí k zachování</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation>Obnovit</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation>Nainstalované balíčky</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation>Vyčistit</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation>Vyčistit %1</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_cs_CZ.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_cs_CZ.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="cs_CZ" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_da.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_da.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="da" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation>Cache-renser - Octopi</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation>Afinstallerede pakker</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation>Behold :</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation>Antal gamle versioner der skal beholdes</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation>Genopfrisk</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation>Installerede pakker</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation>Rens</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation>Rens %1</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_de.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_de.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="de" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation>Zwischenspeicher säubern - Octopi</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation>Deinstallierte Pakete</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation>Behalten:</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation>Anzahl der alten Versionen, die behalten werden: </translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation>Aktualisieren</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation>Installierte Pakete</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation>Säubern</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation>Säubere %1</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_de_AT.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_de_AT.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="de_AT" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_de_DE.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_de_DE.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="de_DE" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_el.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_el.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="el" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation>Καθαριστικό μνήμης cache - Octopi</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation>Μη εγκατεστημένα πακέτα</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation>Διατηρηση:</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation>Αριθμός των παλαιών εκδόσεων για διατηρηση</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation>Ανανέωση</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation>Εγκατεστημένα πακέτα</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation>Εκκαθαριση</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation>Εκκαθαριση %1</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_en.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_en.qm
Normal file
Binary file not shown.
@@ -0,0 +1,55 @@
|
|||||||
|
<?xml version="1.0" encoding="utf-8"?>
|
||||||
|
<!DOCTYPE TS>
|
||||||
|
<TS version="2.1" language="en_US">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="../../ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation type="unfinished"></translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="../../ui/cachecleaner.ui" line="31"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation type="unfinished"></translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="../../ui/cachecleaner.ui" line="42"/>
|
||||||
|
<source>Keep : </source>
|
||||||
|
<translation type="unfinished"></translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="../../ui/cachecleaner.ui" line="65"/>
|
||||||
|
<location filename="../../ui/cachecleaner.ui" line="134"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation type="unfinished"></translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="../../ui/cachecleaner.ui" line="72"/>
|
||||||
|
<location filename="../../ui/cachecleaner.ui" line="141"/>
|
||||||
|
<location filename="../../cachecleaner.cpp" line="282"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation type="unfinished"></translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="../../ui/cachecleaner.ui" line="90"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation type="unfinished"></translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="../../ui/cachecleaner.ui" line="101"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation type="unfinished"></translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="../../ui/cachecleaner.ui" line="108"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation type="unfinished"></translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="../../cachecleaner.cpp" line="303"/>
|
||||||
|
<source>Clean </source>
|
||||||
|
<translation type="unfinished"></translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_en_CZ.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_en_CZ.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="en_CZ" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_en_GB.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_en_GB.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="en_GB" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation>Cache Cleaner - Octopi</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation>Uninstalled packages</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation>Keep :</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation>Number of old versions to keep</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation>Refresh</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation>Installed packages</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation>Clean</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation>Clean %1</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_en_IN.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_en_IN.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="en_IN" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_en_PL.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_en_PL.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="en_PL" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_en_SE.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_en_SE.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="en_SE" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_eo.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_eo.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="eo" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation>Malinstalitaj Pakaĵoj</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation>Konservi :</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation>Refreŝigi</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation>Instalitaj Pakaĵoj</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation>Purigi</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation>Purigi %1</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_es.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_es.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="es" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation>Limpiador de caché</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation>Paquetes desinstalados</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation>Mantener:</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation>Número de versiones antiguas a mantener</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation>Refrescar</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation>Paquetes instalados</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation>Limpiar</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation>Limpiar %1</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="es_419" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation>Limpiador de Cache - Octopi</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation>Paquetes desinstalados</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation>Mantener :</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation>Número de versión anterior a mantener</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation>Actualizar</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation>Paquetes instalados</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation>Limpiar</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation>Limpiar %1</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_es_AR.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_es_AR.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="es_AR" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation>Limpiador de Caché - Octopi</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation>Paquetes desinstalados</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation>Conservar:</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation>Número de versiones antiguas para conservar</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation>Refrescar</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation>Paquetes instalados</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation>Limpiar</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation>Limpiar %1</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_es_CL.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_es_CL.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="es_CL" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation>Limpiador Cache-Octopi</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation>Paquetes desinstalados</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation>Mantener :</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation>Número de versiones anteriores a mantener</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation>Refrescar</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation>Paquetes instalados</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation>Limpiar</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation>Limpiar %1</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_es_CR.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_es_CR.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="es_CR" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_es_ES.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_es_ES.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="es_ES" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation>Limpiador de Caché - Octopi</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation>Paquetes desinstalados</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation>Conservar :</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation>Número de versiones antiguas a conservar:</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation>Refrescar</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation>Paquetes instalados</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation>Limpiar</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation>Limpiar %1</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_es_MX.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_es_MX.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="es_MX" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation>Limpiador de Caché - Octopi</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation>Paquetes desinstalados</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation>Conservar:</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation>Número de versión anterior a conservar</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation>Actualizar</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation>Paquetes instalados</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation>Limpiar</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation>Limpiar %1</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_es_NI.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_es_NI.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="es_NI" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_es_PE.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_es_PE.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="es_PE" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation>Borrar Cache - Octopi</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation>Refrescar</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation>Borrar</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation type="unfinished"/>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_eu.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_eu.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="eu" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation>Cache Garbitzailea - Octopi</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation>Ezabatutako paketeak</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation>Mantendu :</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation>Zenbat bertsio zahar mantendu</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation>Eguneratu</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation>Instalatutako paketeak</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation>Garbitu</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation>%1 Garbitu</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_fa_IR.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_fa_IR.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="fa_IR" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation>Cache Cleaner - Octopi</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation>بسته های حذف شده</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation>نگهداری</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation>تعداد ورژنهایی که باقی میمانند</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation>تازه سازی</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation>بسته های نصب شده</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation>تمیز کردن</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation>پاک کردن 1%</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_fi.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_fi.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="fi" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation>Välimuistin tyhjennys - Octopi</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation>Asentamattomat paketit</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation>Säilytä:</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation>Säilytettävien vanhojen versioiden määrä</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation>Päivitä</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation>Asennetut paketit</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation>Tyhjennä</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation>Tyhjennä %1</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_fi_FI.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_fi_FI.qm
Normal file
Binary file not shown.
@@ -0,0 +1,51 @@
|
|||||||
|
<?xml version="1.0" ?><!DOCTYPE TS><TS language="fi_FI" version="2.0">
|
||||||
|
<context>
|
||||||
|
<name>CacheCleaner</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
|
||||||
|
<source>Cache Cleaner - Octopi</source>
|
||||||
|
<translation>Välimuistin tyhjennys - Octopi</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
|
||||||
|
<source>Uninstalled packages</source>
|
||||||
|
<translation>Asentamattomat paketit</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
|
||||||
|
<source>Keep :</source>
|
||||||
|
<translation>Säilytä:</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
|
||||||
|
<source>Number of old versions to keep</source>
|
||||||
|
<translation>Säilytettävien vanhojen versioiden lukumäärä</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
|
||||||
|
<source>Refresh</source>
|
||||||
|
<translation>Päivitä</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
|
||||||
|
<source>Installed packages</source>
|
||||||
|
<translation>Asennetut paketit</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
<context>
|
||||||
|
<name>PackageGroupModel</name>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
|
||||||
|
<source>Clean</source>
|
||||||
|
<translation>Tyhjennä</translation>
|
||||||
|
</message>
|
||||||
|
<message>
|
||||||
|
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
|
||||||
|
<source>Clean %1</source>
|
||||||
|
<translation>Tyhjennä %1</translation>
|
||||||
|
</message>
|
||||||
|
</context>
|
||||||
|
</TS>
|
||||||
BIN
cachecleaner/resources/translations/octopi_cachecleaner_fr.qm
Normal file
BIN
cachecleaner/resources/translations/octopi_cachecleaner_fr.qm
Normal file
Binary file not shown.
Some files were not shown because too many files have changed in this diff Show More
Reference in New Issue
Block a user