2242 Commits

Author SHA1 Message Date
Alexandre Arnt
6341f8ad9e - Bugfix in refresh 2025-10-18 11:03:08 -03:00
Alexandre Arnt
8afef025a7 - Updated tx 2025-10-18 09:59:40 -03:00
Alexandre Arnt
22791cdbda Updated tx 2025-10-17 20:14:59 -03:00
Alexandre Arnt
d8b4782142 - Change UI option name 2025-10-17 18:37:40 -03:00
Alexandre Arnt
d333d47760 Updated tx 2025-10-17 18:16:17 -03:00
Alexandre Arnt
5540fa8c1b New screenshot 2025-10-17 14:18:40 -03:00
Alexandre Arnt
252fce719c - Small fixes 2025-10-13 13:28:22 -03:00
Alexandre Arnt
572bdabc3b Bugfix in check updates 2025-10-11 16:04:55 -03:00
Alexandre Arnt
45c472ae29 - Bugfix in AUR outdated list 2025-10-11 15:38:42 -03:00
Alexandre Arnt
e4482c4be8 - Bugfixes 2025-10-11 15:33:48 -03:00
Alexandre Arnt
bb7cbee491 - Bugfixes 2025-10-11 11:35:00 -03:00
Alexandre Arnt
9f97fa93af - Bugfixes 2025-10-11 10:22:56 -03:00
Alexandre Arnt
f406cacd91 - Bugfix 2025-10-10 22:14:18 -03:00
Alexandre Arnt
9ea4e2ced0 - bugfix 2025-10-10 22:04:03 -03:00
Alexandre Arnt
219539db7c - Bugfix 2025-10-10 21:55:00 -03:00
Alexandre Arnt
d704996a71 - Make checkupdates available in AUR mode 2025-10-10 21:43:00 -03:00
Alexandre Arnt
cb555b10fa - Condensed text fixes 2025-10-10 16:14:27 -03:00
Alexandre Arnt
02d0413706 Updated CHANGELOG 2025-10-09 14:35:55 -03:00
Alexandre Arnt
eba4b23398 Updated tx 2025-10-09 14:32:53 -03:00
Alexandre Arnt
3509f956d1 - Add the option to make the whole interface text less condensed. 2025-10-09 14:30:55 -03:00
Alexandre Arnt
133a32d1bb Updated changelog 2025-10-09 10:32:00 -03:00
Alexandre Arnt
a7846c9318 Merge pull request #607 from valchx/valchx/show-current-version-on-system-updates
Show current version of the packages on the System Upgrade window
2025-10-09 10:28:39 -03:00
Alexandre Arnt
97dbbb0e28 - Parser fix 2025-10-08 18:33:43 -03:00
Alexandre Arnt
8ec0c319e4 - BugFix in getting news 2025-10-08 17:59:13 -03:00
Valentin Charoux
99ae4eea09 show current version of package on system update 2025-10-08 22:14:20 +02:00
Alexandre Arnt
7ef564da38 - 0.19... 2025-10-08 17:10:26 -03:00
Alexandre Arnt
46c163548c - Use terminal font in output dialog 2025-10-08 17:06:04 -03:00
Alexandre Arnt
2cebca86ba - BugFix: There was a method called more than once every time distro
news was checked.
2025-10-08 16:44:18 -03:00
Alexandre Arnt
19bff087c8 - BugFix: Octopi crashed after using AUR/KCP tool and clicking on a
package anchor in Output tab.
2025-10-08 15:23:52 -03:00
Alexandre Arnt
a6c6384888 - Add Repository field in Info tab. 2025-10-08 14:52:37 -03:00
Alexandre Arnt
8c89906b21 - Add the option to show/hide "Repository" and "Download Size" columns
in package list.
2025-10-08 14:07:57 -03:00
Alexandre Arnt
6c9af10ef0 - Text spacing fixes 2025-10-08 11:27:15 -03:00
Alexandre Arnt
46bbc195a0 updated tx 2025-10-08 09:46:39 -03:00
Alexandre Arnt
73c7f7cfb8 Updated tx 2025-10-04 09:59:37 -03:00
Alexandre Arnt
6f35213ecc - BugFix: Some outdated AUR pkgs were not showing on notifier (thanks to
urbenlegend).
2025-10-04 09:33:40 -03:00
Alexandre Arnt
97c11f0f10 BugFix: Let's not get a description as a pkgname 2025-10-03 17:57:05 -03:00
Alexandre Arnt
dec6656a44 UI changes 2025-10-03 15:21:14 -03:00
Alexandre Arnt
0875030993 - BugFix: Search for BASH also in "/bin". 2025-09-29 17:47:12 -03:00
Alexandre Arnt
4fd9bc265c - BugFix: Under some conditions Octopi could crash due to shared memory
access failures.
2025-09-29 17:28:04 -03:00
Alexandre Arnt
8781695048 Merge branch 'master' of https://github.com/aarnt/octopi 2025-09-28 20:54:20 -03:00
Alexandre Arnt
4fa4562e65 - Parser fixes 2025-09-28 20:54:07 -03:00
Alexandre Arnt
196e282924 - BugFix: List of outdated KCP packages was not working in KaOS. 2025-09-28 18:17:17 -03:00
Alexandre Arnt
3fc49cb3aa Parser fix 2025-09-28 17:16:47 -03:00
Alexandre Arnt
ab31f28308 Release prep 2025-09-28 16:30:06 -03:00
Alexandre Arnt
dc23455cce Release prep 2025-09-28 16:14:20 -03:00
Alexandre Arnt
51f4d66d1a - BugFix: Force use of BASH shell was not working (thanks to
UnsaltedScholar).
2025-09-28 15:59:44 -03:00
Alexandre Arnt
7aef1f07f8 - Important bugfixes 2025-09-28 12:52:48 -03:00
Alexandre Arnt
1ff216543d Bugfix in french tx 2025-09-28 11:11:12 -03:00
Alexandre Arnt
275655ff61 new dev cycle 2025-09-26 14:10:20 -03:00
Alexandre Arnt
5fefb275c2 Updated tx 2025-09-25 17:29:50 -03:00
Alexandre Arnt
6466b3604f Release prep 2025-09-20 15:30:00 -03:00
Alexandre Arnt
93726ee571 Updated tx and README 2025-09-16 19:22:25 -03:00
Alexandre Arnt
0146c29419 - Parser fix 2025-09-15 18:04:11 -03:00
Alexandre Arnt
e54977c340 - new screenshot 2025-09-15 17:46:39 -03:00
Alexandre Arnt
5b3bc51990 - BugFix in helper 2025-09-15 17:16:22 -03:00
Alexandre Arnt
7b365a1f14 - Disable About from Notifier 2025-09-15 16:53:26 -03:00
Alexandre Arnt
e4fdedaf33 - Bugfixes 2025-09-15 16:13:53 -03:00
Alexandre Arnt
848239572d - BugFix in parser 2025-09-15 15:40:32 -03:00
Alexandre Arnt
e1d9e85945 - BugFix in parser code. 2025-09-15 15:29:04 -03:00
Alexandre Arnt
42a7c320d9 - BugFix in enable/disable UI 2025-09-15 14:54:31 -03:00
Alexandre Arnt
d03b5a84d0 Bugfix 2025-09-15 11:37:37 -03:00
Alexandre Arnt
1e6b2db303 Changed resource name 2025-09-14 08:54:28 -03:00
Alexandre Arnt
a6785e9b7c Changed resource name 2025-09-14 08:50:00 -03:00
Alexandre Arnt
c25ed66c0c - BugFix in search method save logic 2025-09-12 11:24:15 -03:00
Alexandre Arnt
4df0d961e6 Add octopi icon 2025-09-12 10:43:19 -03:00
Alexandre Arnt
aea5e70748 - BugFix 2025-09-11 20:19:20 -03:00
Alexandre Arnt
e9136182c9 - Bugfix 2025-09-11 20:09:46 -03:00
Alexandre Arnt
86288068fa - Added support for garuda-update command when running in Garuda Linux. 2025-09-11 18:51:49 -03:00
Alexandre Arnt
331bec30c8 Added pre-system-upgrade example script 2025-09-11 17:42:10 -03:00
Alexandre Arnt
7cae2d7586 Updated tx 2025-09-11 15:56:34 -03:00
Alexandre Arnt
1b202a25f8 Updated tx 2025-09-11 14:35:22 -03:00
Alexandre Arnt
fae056ec81 - Search option selected by the user is saved on close. 2025-09-10 20:13:48 -03:00
Alexandre Arnt
9dcf3ed14d Updated tx 2025-09-10 09:10:04 -03:00
Alexandre Arnt
f19e55220e - Updated tx 2025-09-08 18:21:02 -03:00
Alexandre Arnt
6938c1f833 - Bugfix in context menu 2025-09-08 18:17:38 -03:00
Alexandre Arnt
7208096fdc - Bugfixes in KCP code 2025-09-08 17:49:16 -03:00
Alexandre Arnt
c4a9677667 Bugfix 2025-09-08 17:11:17 -03:00
Alexandre Arnt
0993cda3a0 - Updated tx 2025-09-08 16:52:52 -03:00
Alexandre Arnt
8bed4c0e46 - Bugfix 2025-09-08 16:14:12 -03:00
Alexandre Arnt
9fdd1a5e89 - bugfix 2025-09-08 16:10:37 -03:00
Alexandre Arnt
1cb421c284 - Added View/Ignored menu option. 2025-09-08 15:29:05 -03:00
Alexandre Arnt
20c2472aa1 Updated screenshot 2025-09-05 18:09:46 -03:00
Alexandre Arnt
dcb99d28ec - Release preparation 2025-09-05 17:40:16 -03:00
Alexandre Arnt
d7e103388a Updated tx 2025-09-05 17:23:36 -03:00
Alexandre Arnt
1ec036202b Updated tx 2025-09-04 17:17:30 -03:00
Alexandre Arnt
a783507d60 Updated tx 2025-09-04 13:04:39 -03:00
Alexandre Arnt
b2c82af9f4 Updated tx 2025-09-04 09:57:38 -03:00
Alexandre Arnt
aaf1e5f6d6 - Bugfix in KaOS rss 2025-09-01 18:46:09 -03:00
Alexandre Arnt
197398e3bc - Bugfix 2025-09-01 18:38:39 -03:00
Alexandre Arnt
38308ac0d0 - Update KaOS rss url 2025-09-01 18:33:03 -03:00
Alexandre Arnt
e0e97795f3 - BugFix 2025-09-01 14:21:18 -03:00
Alexandre Arnt
0b02c78704 - Bugfix in helper 2025-09-01 14:06:27 -03:00
Alexandre Arnt
c7f101f67f Release prep 2025-09-01 13:54:20 -03:00
Alexandre Arnt
ee70dc46a2 - Bugfix 2025-09-01 10:00:28 -03:00
Alexandre Arnt
aafa8522ea Updated tx 2025-09-01 09:25:13 -03:00
Alexandre Arnt
b9b4913bbc Updated tx 2025-08-31 16:50:24 -03:00
Alexandre Arnt
cdc2013cbb - Updated tx 2025-08-29 17:53:30 -03:00
Alexandre Arnt
04adf88088 - Updated tx 2025-08-29 17:50:55 -03:00
Alexandre Arnt
a1d064fbe0 - Updated tx 2025-08-29 17:49:32 -03:00
Alexandre Arnt
150763f0e3 - Added another cmd 2025-08-29 16:37:51 -03:00
Alexandre Arnt
c3afa378d1 - Added support for a user specified backup shell script that needs to
be placed at "/usr/lib/octopi/pre-system-upgrade-script.sh" and executes
before the system upgrades.
2025-08-29 16:00:14 -03:00
Alexandre Arnt
70b8bc97ae - Bugfixes in options dialog. 2025-08-29 11:30:18 -03:00
Alexandre Arnt
256e862382 - Added "Get Latest distro news" menu item to the News tab context menu. 2025-08-29 11:06:04 -03:00
Alexandre Arnt
569e5fe133 - Bugfix 2025-08-29 10:57:34 -03:00
Alexandre Arnt
0d7dd83354 - Added support for Plus and Minus keys to add and remove packages from
the system.
2025-08-29 10:18:37 -03:00
Alexandre Arnt
241ae97423 - Bugfix 2025-08-29 10:00:30 -03:00
Alexandre Arnt
11867b1ee6 - Added support for pacman.conf's IgnorePkg option through "Add to
Ignored" and "Remove from Ignored" actions from the context menu in the
package list.
2025-08-29 09:53:01 -03:00
Alexandre Arnt
603c477ef0 - Initial support for IgnorePkg 2025-08-28 16:00:49 -03:00
Alexandre Arnt
be52ee78a7 - BugFix: Use system theme folder icon in Files tab.
- BugFix: Package list refresh was not running after a group install/
removal.
2025-08-25 19:55:36 -03:00
Alexandre Arnt
840aef9bb9 - Added Apply and Cancel buttons also in the Actions tab. 2025-08-25 17:53:11 -03:00
Alexandre Arnt
dfeb189940 - Updated tx 2025-08-25 13:07:30 -03:00
Alexandre Arnt
07161db266 - BugFix: Make Actions tab visible when a package is selected for
insertion/removal.
2025-08-25 10:55:54 -03:00
Alexandre Arnt
77f6ea88aa - Bugfix 2025-08-25 10:32:08 -03:00
Alexandre Arnt
139950ab25 - BugFix: select Help tab when Octopi runs for the first time. 2025-08-25 10:01:36 -03:00
Alexandre Arnt
c22834118c - BugFix: Use user-selected search option while octopi is running. 2025-08-24 20:23:13 -03:00
Alexandre Arnt
e156b543f5 - Added Tools/pacman-key option to refresh pacman gpg keys. 2025-08-24 18:36:19 -03:00
Alexandre Arnt
4d3278567b - Bugfix 2025-08-24 16:48:33 -03:00
Alexandre Arnt
ce66ccbf03 - Modernization of Options dialog. 2025-08-24 16:36:03 -03:00
Alexandre Arnt
f83f596ce8 Updated tx 2025-08-24 10:30:57 -03:00
Alexandre Arnt
9c047a024c - Debug for pkg contents size 2025-08-22 17:58:12 -03:00
Alexandre Arnt
d4a32751f3 - new defaults 2025-08-22 15:53:03 -03:00
Alexandre Arnt
ab9f709dc2 - Fix icons dir 2025-08-22 13:44:52 -03:00
Alexandre Arnt
bcb2217f49 Updated tx 2025-08-22 13:29:52 -03:00
Alexandre Arnt
dce264509f - Removed unused code and added test code. 2025-08-22 13:25:15 -03:00
Alexandre Arnt
927f208f78 - Bugfix 2025-08-22 11:43:43 -03:00
Alexandre Arnt
93b42b40d4 - Log 2025-08-22 11:40:32 -03:00
Alexandre Arnt
3184a4b17e - Bugfix 2025-08-22 11:32:26 -03:00
Alexandre Arnt
18b4d36f85 - Bugfix in code. 2025-08-22 11:24:21 -03:00
Alexandre Arnt
4c7f7e2b09 - Bugfix in code. 2025-08-22 10:29:06 -03:00
Alexandre Arnt
faa80775a5 - Fix tool name 2025-08-22 10:25:10 -03:00
Alexandre Arnt
7ab4e7fce5 - Adjust for new code. 2025-08-22 10:06:54 -03:00
Alexandre Arnt
cc105bf2e1 - BugFix: Use better way to detect if user is running the tools from the
right place.
2025-08-22 09:44:05 -03:00
Alexandre Arnt
367e8ad750 Updated tx 2025-08-22 09:11:45 -03:00
Alexandre Arnt
6892f5f3c1 - bugfix 2025-08-21 20:13:04 -03:00
Alexandre Arnt
b23353a1f5 - Added CachyOS options. 2025-08-21 20:10:37 -03:00
Alexandre Arnt
9986b1a2cb Updated tx 2025-08-21 18:57:28 -03:00
Alexandre Arnt
4d67fa44e4 Updated tx 2025-08-21 18:21:45 -03:00
Alexandre Arnt
993b95420f - BugFix: qt-sudo now respects user locale settings. 2025-08-21 16:52:00 -03:00
Alexandre Arnt
f4462b9379 - Added "Enable package tooltips" option, so users can disable the
feature when needed.
- Added "Force use of BASH shell" option to ensure compatibility when
the user uses another SHELL.
2025-08-21 15:34:25 -03:00
Alexandre Arnt
c43d148dd7 - Removed debug msg. 2025-08-21 14:29:22 -03:00
Alexandre Arnt
a508fb7b11 - Removed buggy strings. 2025-08-21 14:23:47 -03:00
Alexandre Arnt
6590909116 - Removed non working test. 2025-08-21 14:07:16 -03:00
Alexandre Arnt
44df329672 Merge branch 'master' of https://github.com/aarnt/octopi 2025-08-11 13:59:25 -03:00
Alexandre Arnt
96896f8a87 Updated tx 2025-08-11 13:59:16 -03:00
Alexandre Arnt
448c620c8a Updated README file 2025-05-30 15:46:08 -03:00
Alexandre Arnt
2ec8dbde08 Updated tx 2025-05-25 08:39:09 -03:00
Alexandre Arnt
48fc54d24b - BugFix: Notifier did not fetch updates for the first time when using
"once a day".
2025-05-10 11:44:04 -03:00
Alexandre Arnt
79dd707276 Updated tx 2025-05-10 10:27:57 -03:00
Alexandre Arnt
b1a6fb069c Updated tx 2025-04-26 10:38:16 -03:00
Alexandre Arnt
fb46f9acaa Updated tx 2025-03-15 10:38:54 -03:00
Alexandre Arnt
c86d07aac7 Trying one more time to handle aur params in zsh shell 2025-02-24 11:08:14 -03:00
Alexandre Arnt
c1f24851ea tx 2025-02-22 08:22:21 -03:00
Alexandre Arnt
771b7894ba - Bugfix in test 2025-02-20 19:12:24 -03:00
Alexandre Arnt
aed9f6e27c - BugFix: The act of moving the mouse over the package list was
triggering many "pacman -Si" executions (thanks to RAZUMNO)
2025-02-20 11:03:46 -03:00
Alexandre Arnt
f481213f69 Another cycle begins... 2025-02-19 11:17:21 -03:00
Alexandre Arnt
ab61b62e6d Update tx 2025-02-19 11:12:54 -03:00
Alexandre Arnt
dfb20233f8 Release date 2025-02-18 13:06:33 -03:00
Alexandre Arnt
9c7ed8cfaf - Remove ampersand from Options menu in notifier 2025-02-18 11:23:10 -03:00
Alexandre Arnt
3f25b41b31 Updated file 2025-02-17 19:50:35 -03:00
Alexandre Arnt
3283bec5a5 - Updated tx and release-translations.sh util. 2025-02-17 17:22:26 -03:00
Alexandre Arnt
ec61b6d688 - Clean unused code 2025-02-17 17:15:33 -03:00
Alexandre Arnt
b61d4601e2 Release prep 2025-02-15 19:34:50 -03:00
Alexandre Arnt
938c2403e0 Updated tx 2025-02-15 19:12:59 -03:00
Alexandre Arnt
8f13832c20 Release prep 2025-02-14 17:37:46 -03:00
Alexandre Arnt
2f2709faf1 Updated tx 2025-02-14 17:35:20 -03:00
Alexandre Arnt
c3fd32dc41 Updated tx 2025-02-13 18:46:29 -03:00
Alexandre Arnt
72287b3b88 - Do not translate 2 strings 2025-02-13 18:29:49 -03:00
Alexandre Arnt
4efd887252 - Adjust notifier too 2025-02-13 17:34:28 -03:00
Alexandre Arnt
ab08faaa5b - New str 2025-02-13 17:24:14 -03:00
Alexandre Arnt
6ca2083e03 - Added option to always use the terminal when executing pacman actions. 2025-02-13 17:01:51 -03:00
Alexandre Arnt
2fb3fdc98f - "Always Use the Terminal" code begins. 2025-02-12 19:53:21 -03:00
Alexandre Arnt
3853ca6ebd - Prefer BASH shell when executing commands. 2025-01-19 10:47:37 -03:00
Alexandre Arnt
da166f3f12 Updated tx 2025-01-05 11:04:51 -03:00
Alexandre Arnt
caec196c2e Merge pull request #577 from Integral-Tech/qstring-refactor
refactor: use arg() to enhance readability of string concatenation
2025-01-04 10:44:46 -03:00
Alexandre Arnt
190a7212eb Updated tx 2025-01-04 10:14:00 -03:00
Alexandre Arnt
3d14a55613 Udpated tx 2024-12-22 15:41:18 -03:00
Alexandre Arnt
944b792fb6 Udpated tx 2024-12-21 08:40:16 -03:00
Integral
35e7f07dda refactor: use arg() to enhance readability of string concatenation 2024-12-19 00:59:00 +08:00
Alexandre Arnt
011e7f0ab3 Merge pull request #576 from Integral-Tech/qstring-refactor
refactor: remove redundant QString() constructor calls
2024-12-18 13:15:29 -03:00
Integral
0619e7abef refactor: remove redundant QString() constructor calls 2024-12-18 21:09:37 +08:00
Alexandre Arnt
5afd387086 - Improvement: Let user choose which domain is pinged when checking for
internet access (if ping.archlinux.org is down).
2024-12-15 11:42:55 -03:00
Alexandre Arnt
9f8ca68053 Updated tx 2024-12-15 10:07:01 -03:00
Alexandre Arnt
6ef685235e - BugFix in aurtool params. 2024-11-09 11:33:49 -03:00
Alexandre Arnt
71451bc6b2 Updated tx 2024-11-03 08:55:44 -03:00
Alexandre Arnt
981c27d5db - Added "--editmenu" checkbox on Options dialog if you are using Yay
tool.
2024-10-05 12:22:29 -03:00
Alexandre Arnt
d98b35416f Updated tx 2024-09-28 17:28:06 -03:00
Alexandre Arnt
036ad9fa9e Updated tx 2024-09-15 10:19:20 -03:00
Alexandre Arnt
742c0c9450 Updated tx 2024-09-11 19:09:53 -03:00
Alexandre Arnt
5e2bc3d28d Updated tx 2024-09-11 18:30:12 -03:00
Alexandre Arnt
aa79b18143 - Warning busting. 2024-09-11 17:31:12 -03:00
Alexandre Arnt
8b42b92441 - Fix on play bell sound code. 2024-09-11 14:43:12 -03:00
Alexandre Arnt
ea20c392fe - Add "Play a bell sound" option to the General tab on optionsdialog. 2024-09-11 14:38:16 -03:00
Alexandre Arnt
4fe3873793 - Play a bell sound when the Terminal tab is asking for the user
password.
2024-09-09 20:13:41 -03:00
Alexandre Arnt
d984e110cb Updated tx 2024-09-08 08:54:08 -03:00
Alexandre Arnt
307d00c930 - Use "pacman -Qi" for "outdated" and "newer" pkgs. 2024-08-31 20:30:53 -03:00
Alexandre Arnt
ded9985f1d Updated tx 2024-08-31 09:56:02 -03:00
Alexandre Arnt
1737c189d6 Updated tx 2024-08-27 17:05:48 -03:00
Alexandre Arnt
fef6647228 - Updated tx. 2024-08-27 10:53:31 -03:00
Alexandre Arnt
22d8dbeb7b - BugFix: Help msg for newer packages was wrong because they're not
installed.
2024-08-27 10:30:17 -03:00
Alexandre Arnt
11f0244c14 Merge branch 'master' of https://github.com/aarnt/octopi 2024-08-26 14:42:07 -03:00
Alexandre Arnt
e92ae9e2ad Updated tx 2024-08-26 14:41:59 -03:00
Alexandre Arnt
da22dd0494 Merge pull request #566 from adolfintel/master
Use ping.archlinux.org for connectivity check
2024-08-21 11:33:33 -03:00
Federico Dossena
da78109d95 Use ping.archlinux.org for connectivity check 2024-08-21 10:34:22 +02:00
Alexandre Arnt
cb75753731 Updated tx 2024-08-15 17:39:57 -03:00
Alexandre Arnt
a2ef33a2c9 Merge pull request #565 from utuhiro78/master
Fix the Transifex page
2024-08-13 13:38:26 -03:00
utuhiro78
9e78ec4399 Fix the Transifex page 2024-08-13 18:04:19 +09:00
Alexandre Arnt
9fd06ba0a6 Updated tx 2024-08-03 10:05:33 -03:00
Alexandre Arnt
ef303c9cbe - Update parser. 2024-07-28 12:02:49 -03:00
Alexandre Arnt
5b95de1dc8 Updated pt_BR tx 2024-07-27 22:13:33 -03:00
Alexandre Arnt
7ea04ad750 - String fix 2024-07-21 10:06:15 -03:00
Alexandre Arnt
886b111b78 - BugFix: Code for EndeavorOS news was incomplete (thanks to
LegitGreenBoi).
2024-07-21 10:05:04 -03:00
Alexandre Arnt
bbd78805bf Updated tx 2024-07-13 15:15:33 -03:00
Alexandre Arnt
a09e782ead Updated tx 2024-06-30 10:15:12 -03:00
Alexandre Arnt
10b51b1416 - Improvement: Show a "Collecting transaction data..." msg before
presenting the transaction dialog, as it can be quite slow on some
systems (thanks to Valdir).
2024-06-23 19:49:12 -03:00
Alexandre Arnt
429bd605d4 Updated CHANGELOG 2024-06-20 19:30:17 -03:00
Alexandre Arnt
a12054032a Updated tx 2024-06-20 19:27:39 -03:00
Alexandre Arnt
dcc00671ee - BugFix: Increased width of Terminal tab labels on optionsdialog.
- BugFix: Removed a debug msg when octopi was not being executed with "-
d".
2024-06-17 19:39:26 -03:00
Alexandre Arnt
49555c98ba Preparation for 0.16.2 2024-06-17 19:03:46 -03:00
Alexandre Arnt
94f489a0b1 updated tx 2024-06-14 09:12:43 -03:00
Alexandre Arnt
91e00c84d2 - Mais uma vez... 2024-06-10 09:13:53 -03:00
Alexandre Arnt
1e3b31cc1c release prep 2024-06-09 18:07:17 -03:00
Alexandre Arnt
483064a956 - BugFix: Could not remove packages when internet connection was down
(thanks to Theluga).
2024-06-08 19:46:36 -03:00
Alexandre Arnt
8a3731b072 - Updated translations 2024-06-08 10:08:41 -03:00
Alexandre Arnt
ebf4ad9df9 - Updated translations 2024-06-06 21:47:18 -03:00
Alexandre Arnt
8aa2abe5ff - Unused?? 2024-06-06 19:53:51 -03:00
Alexandre Arnt
ddd97fd5ba fix optionsdialog ui 2024-06-06 19:46:55 -03:00
Alexandre Arnt
fe5df3e8a2 - version 0.16.1 prep 2024-06-06 17:36:04 -03:00
Alexandre Arnt
5bb8de6b6e - fix str 2024-06-06 16:29:12 -03:00
Alexandre Arnt
3408bebc0c - fix str 2024-06-06 16:27:09 -03:00
Alexandre Arnt
56641548d9 - str fix. 2024-06-06 16:12:55 -03:00
Alexandre Arnt
973fb2a473 - fix 2024-06-06 15:48:51 -03:00
Alexandre Arnt
fe4c704892 - fix 2024-06-06 15:46:09 -03:00
Alexandre Arnt
cb7b571dcc - fix 2024-06-06 15:45:17 -03:00
Alexandre Arnt
4afdd15784 - fix 2024-06-06 15:38:38 -03:00
Alexandre Arnt
53ea9fc062 - Version bump 2024-06-06 14:13:14 -03:00
Alexandre Arnt
e3d37d6f3d - BugFix: Do not install notifier's desktop file in /etc/xdg/autostart. 2024-06-06 13:55:34 -03:00
Alexandre Arnt
db9d26f858 - a small test. 2024-06-06 13:27:55 -03:00
Alexandre Arnt
e9c98087bc - BugFix: Info/Files tabs were always empty if they were selected at
octopi's start.
2024-06-06 10:18:15 -03:00
Alexandre Arnt
dff5d0ea9f - Arrow key navegation refreshes Info and Files tabs again. 2024-06-05 20:11:03 -03:00
Alexandre Arnt
6e7e3c6f4c - Added shortcut key "Ctrl+Shift+U" to upgrade outdated AUR packages. 2024-06-05 19:32:30 -03:00
Alexandre Arnt
bc44fa3d78 - Small fix in Files Tab code. 2024-06-05 13:30:43 -03:00
Alexandre Arnt
5cb760d1dc updated arabic tx 2024-05-27 20:04:17 -03:00
Alexandre Arnt
1ff9761e13 updated arabic tx 2024-05-27 20:04:00 -03:00
Alexandre Arnt
5d08cb59d6 Updated polish tx 2024-05-26 09:48:53 -03:00
Alexandre Arnt
33bdea2850 Merge branch 'master' of https://github.com/aarnt/octopi 2024-05-25 20:25:39 -03:00
Alexandre Arnt
9887f40a08 - BugFix: Updated some LANG environment variables to C.UTF-8. 2024-05-25 20:22:52 -03:00
Alexandre Arnt
8751898bd0 Merge pull request #557 from SGOrava/notifier-kf6
Fix building octopi-notifier with KF6
2024-05-25 19:35:55 -03:00
5af7cd8abc Fix building octopi-notifier with KF6
Use `KF6StatusNotifierItem` instead of `KF6Notifications`.

Signed-off-by: Juraj Oravec <jurajoravec@mailo.com>
2024-05-21 21:22:08 +02:00
Alexandre Arnt
1dbebc4ccc Bugfix in PKGBUILD 2024-05-19 12:34:04 -03:00
Alexandre Arnt
cf0122f936 -Updated translations. 2024-05-19 12:17:46 -03:00
Alexandre Arnt
05a1d28850 - 0.16.0 prep 2024-05-19 11:55:25 -03:00
Alexandre Arnt
99bc556cf3 - 0.16.0 prep 2024-05-19 11:04:23 -03:00
Alexandre Arnt
8c508c91c8 msg fix 2024-05-18 19:54:32 -03:00
Alexandre Arnt
e0708b73b6 - Default to Qt6 libs 2024-05-18 19:32:49 -03:00
Alexandre Arnt
aad8ac342e Preparing for 0.16.0 2024-05-18 19:11:09 -03:00
Alexandre Arnt
435f0281e5 - Bugfix in KSTATUS/pro 2024-05-18 17:50:35 -03:00
Alexandre Arnt
a081ac2bfd - Default to Qt6 lib build 2024-05-18 14:51:58 -03:00
Alexandre Arnt
d0fbc89b9e - Fix for QTERMWIDGET6 compat 2024-05-18 14:20:38 -03:00
Alexandre Arnt
eebfa41342 - Fix for QTERMWIDGET6 compat 2024-05-18 14:13:27 -03:00
Alexandre Arnt
a974769a4c - Updated qt-sudo strings. 2024-05-11 10:42:34 -03:00
Alexandre Arnt
69e85dddd2 Updated PKGBUILD file. 2024-03-11 09:17:30 -03:00
Alexandre Arnt
4f6101f1af - Removed buggy str. 2024-03-10 22:30:25 -03:00
Alexandre Arnt
644c5a3d78 - Fixed a typo. 2024-03-10 22:22:38 -03:00
Alexandre Arnt
cd32995a81 - Now using unified qt-sudo project. 2024-03-10 22:03:37 -03:00
Alexandre Arnt
64e72f06c9 - BugFix in notifier. 2024-03-04 19:44:39 -03:00
Alexandre Arnt
9037688da5 Fixed silent error when pacman's database is locked (thanks to SloppyPuppy). 2024-01-22 08:53:43 -03:00
Alexandre Arnt
8f9647e58f Merge pull request #546 from SloppyPuppy/master
fixed silent fail when pacman running
2024-01-22 08:50:08 -03:00
Момчило Ињац
039824122b fixed silent fail when pacman running 2024-01-21 11:50:07 +01:00
Alexandre Arnt
59c785f364 - BUGFIX: Yay AUR search was not working anymore. 2024-01-20 10:22:34 -03:00
Alexandre Arnt
f79da34b3e - BugFix: '--noeditmenu' is deprecated. Use '--editmenu=false' instead
(thanks to rbaruccojr).
2023-12-29 19:47:38 -03:00
Alexandre Arnt
b2e6dfc8a2 - Added files 2023-12-29 19:43:09 -03:00
Alexandre Arnt
3397776586 - Updated CHANGELOG. 2023-12-29 19:31:14 -03:00
Alexandre Arnt
d308c470eb - Another dev cycle begins... 2023-12-29 19:29:35 -03:00
Alexandre Arnt
a07a3a9b38 Merge pull request #540 from MatMoul/patch-1
Update PKGBUILD
2023-11-10 07:32:13 -03:00
MatMoul
71759c8f7e Update PKGBUILD
Update sed for knotifier.

The curent sed cmd don't match the regular expression!
2023-10-23 23:24:19 +02:00
Alexandre Arnt
b4301d72cc - Release preparation. 2023-09-10 22:35:35 -03:00
Alexandre Arnt
27f5df6aef - Updated translations. 2023-09-10 20:54:35 -03:00
Alexandre Arnt
0cddcd876d - Always recreate helper log file. 2023-09-09 20:25:17 -03:00
Alexandre Arnt
8a9465738d Removed unused pkg 2023-09-09 19:35:03 -03:00
Alexandre Arnt
1416d16f49 - Using "pacman -Fl" to view contents of non installed packages (thanks
to Zesko).
2023-09-09 19:32:36 -03:00
Alexandre Arnt
d99839e7e9 - Small bugfix. 2023-09-09 16:51:25 -03:00
Alexandre Arnt
2521696214 - Bunch of bugfixes. 2023-09-09 15:53:20 -03:00
Alexandre Arnt
24a1423de0 - Parser fixes. 2023-09-08 23:30:07 -03:00
Alexandre Arnt
6d97331ff2 - Garuda Linux string parsing. 2023-09-08 23:19:01 -03:00
Alexandre Arnt
f60d7d971e - Small bugFixes. 2023-08-27 14:07:48 -03:00
Alexandre Arnt
d8a1722d2a - Fix in octopi helper code. 2023-08-26 11:09:04 -03:00
Alexandre Arnt
9085b6ca56 - BugFix: Change install reason did not work with pacman backend. 2023-08-26 11:00:59 -03:00
Alexandre Arnt
bebc5d1276 - Removed unused code. 2023-08-26 09:44:11 -03:00
Alexandre Arnt
bbccd59fed - Fix in helper code. 2023-08-26 09:36:16 -03:00
Alexandre Arnt
1335406977 - Enable again the helper logfile. 2023-08-25 17:59:07 -03:00
Alexandre Arnt
e7f783cc52 - Remove unused code. 2023-08-24 18:07:56 -03:00
Alexandre Arnt
a4d718b8b7 Added support for Qt5/Qt6 libs 2023-08-15 20:24:34 -03:00
Alexandre Arnt
1fa610f194 - Added support for both Qt5 and Qt6 libs. 2023-08-13 16:25:59 -03:00
Alexandre Arnt
f59315cd60 Support both Qt5 and Qt6 libs 2023-08-13 11:05:23 -03:00
Alexandre Arnt
712a43f39e - Made the code a bit more Qt6 friendly. 2023-08-01 17:37:09 -03:00
Alexandre Arnt
7e3c26adbf - Made the code a bit more Qt6 friendly. 2023-08-01 16:32:31 -03:00
Alexandre Arnt
030efb79b5 - Made the code a little bit more Qt6 friendly. 2023-08-01 16:10:42 -03:00
Alexandre Arnt
43b7e86f84 - Fixed sizes. 2023-07-24 22:39:15 -03:00
Alexandre Arnt
f403fd7f9a - Added a Terminal tab to options dialog to config its colors and fonts. 2023-07-24 22:35:40 -03:00
Alexandre Arnt
dfb0062aa0 - BugFix in octopi/notifier Updates tab code. 2023-07-24 09:28:02 -03:00
Alexandre Arnt
455ae4853f - BugFix: When using the pacman backend, call "pacman -Qm" to fetch ALL
foreign packages.
2023-07-23 09:36:28 -03:00
Alexandre Arnt
8d7e4eac39 - Stop calling Octopi's option dialog when Octopi was running. 2023-07-23 09:21:14 -03:00
Alexandre Arnt
71dcb5fdcb Updated files 2023-07-04 11:05:52 -03:00
Alexandre Arnt
7fdabbe9ef - BugFix: AUR passwords that contain a "+" char failed to login at
aur.archlinux.org.
2023-07-03 16:46:41 -03:00
Alexandre Arnt
630f4efd17 Fix in helper code. 2023-06-20 17:11:20 -03:00
Alexandre Arnt
4b12c8b06f - Better error logic in helper code. 2023-06-17 10:07:58 -03:00
Alexandre Arnt
c5f1e9694d - PressAnyKeyToContinue equals PAKtC now. 2023-06-17 10:00:01 -03:00
Alexandre Arnt
cbd43ab731 - Octopi-sudo code was synced to match project "lxqt-sudo" version
1.3.0.
2023-06-08 11:26:39 -03:00
Alexandre Arnt
1166691c37 - BugFix: Polished navigation on Info tab dependencies 2023-06-08 11:14:37 -03:00
Alexandre Arnt
e98fec0fb9 - Trying to fix Helper's aborted transactions caused by broken string
errors.
2023-06-08 09:30:39 -03:00
Alexandre Arnt
d0a30a9eca - BugFix: First yay-bin download now works again. 2023-05-22 14:26:27 -03:00
Alexandre Arnt
a92868cbb3 Merge pull request #522 from ShalokShalom/patch-1
fix typo
2022-12-20 07:22:43 -03:00
ShalokShalom
db36d56be9 fix typo 2022-12-20 03:58:28 +01:00
Alexandre Arnt
2db10e3b4b - Octopi-sudo code was synced to match project "lxqt-sudo" version
1.2.0.
2022-11-05 11:11:39 -03:00
Alexandre Arnt
3e3acfde39 - BugFix: Better handle dependencies while staging packages for
deletion.
2022-11-02 21:53:09 -03:00
Alexandre Arnt
a994beb935 - BugFix: invalidate Info/File tabs when user is navigating packages
using the keyboard.
2022-10-29 09:41:04 -03:00
Alexandre Arnt
144a8ca86e - Another dev cycle (0.15) begins... 2022-10-23 09:52:43 -03:00
Alexandre Arnt
462bfec623 - Updated CMakeLists.txt file. 2022-10-05 22:37:48 -03:00
Alexandre Arnt
0a47127c71 - Release preparation... 2022-10-05 22:19:02 -03:00
Alexandre Arnt
ba9a934c7c - BugFix: Package search did not work correctly when query string
contained a "+" sign.
2022-10-04 22:35:06 -03:00
Alexandre Arnt
d726e53976 - BugFix: AUR search did not work correctly when query string contained
a "+" sign.
2022-10-03 22:15:26 -03:00
Alexandre Arnt
06c42e047e Updated translations 2022-09-24 16:21:07 -03:00
Alexandre Arnt
5abd25ff76 Update README.md
Updated README file. RIP Chakra :-(
2022-09-15 11:18:54 -03:00
Alexandre Arnt
15f33ee87c Update CHANGELOG
Updated CHANGELOG
2022-09-15 11:07:40 -03:00
Alexandre Arnt
8b4db5bbd3 - Removed unneeded code. 2022-07-25 16:30:58 -03:00
Alexandre Arnt
a4687d1a95 - Added --overwrite="*" checkbox in AUR tab (Tools/Options) when using
yay.
2022-07-25 16:24:24 -03:00
Alexandre Arnt
1a44290006 Updated translations 2022-07-25 09:44:27 -03:00
Alexandre Arnt
d16f189c72 BugFix: Info/Files tab refresh was duplicated (another try). 2022-06-26 11:21:43 -03:00
Alexandre Arnt
3ce25e63c5 - BugFix: Info/Files tab refresh was duplicated;
- BugFix: Disable (another try) Info/Files tab refresh while typing in
Filter/Search line edit;
- Updated translations.
2022-06-25 11:11:55 -03:00
Alexandre Arnt
029ecfbedf - Synced octopi-sudo code with lxqt-sudo version 1.1.0. 2022-05-01 11:02:59 -03:00
Alexandre Arnt
1b8d9aca43 Again and again... 2022-04-16 09:05:12 -03:00
Alexandre Arnt
00b40f1a87 Play it again, Sam 2022-04-16 09:01:09 -03:00
Alexandre Arnt
fd0307f033 Release preparation 2022-03-30 13:10:59 -03:00
Alexandre Arnt
0e9e3be096 Release preparation 2022-03-30 13:09:32 -03:00
Alexandre Arnt
18ed4434b0 Release preparation 2022-03-30 13:04:29 -03:00
Alexandre Arnt
3b03f26086 - Fix compile warning 2022-03-30 12:50:39 -03:00
Alexandre Arnt
f73ff0c5ea Updated repoeditor CMakeLists 2022-03-30 12:32:57 -03:00
Alexandre Arnt
b2507b5b74 - Fixed a compilation warning;
- Added a desktop file to Repository Editor;
- Updated desktop files
- Bumped version to 0.13.0
2022-03-30 11:26:02 -03:00
Alexandre Arnt
31d1fd5896 Updated translations 2022-03-28 11:55:52 -03:00
Alexandre Arnt
96c29a1304 Merge pull request #512 from nicolasfella/singlewindow
Mark as single window app
2022-03-22 07:20:40 -03:00
Nicolas Fella
849bd94007 Mark as single window app
There can only be one main window at a time, mark it as such in the desktop file

That way desktop environments know to not offer to open a second window
2022-03-22 00:28:35 +01:00
Alexandre Arnt
8ae9a89e88 - Added option to update the selected outdated AUR pkg directly from the
main list.
2022-03-20 22:45:06 -03:00
Alexandre Arnt
4fd04ad81c - Remove unused code. 2022-03-04 12:03:04 -03:00
Alexandre Arnt
8e9fe4a3c7 Updated CHANGELOG 2022-03-04 11:59:14 -03:00
Alexandre Arnt
27d35b4ff3 - Small fix in notifier code. 2022-03-03 22:36:55 -03:00
Alexandre Arnt
242d1eae2f - Bump Octopi version in PKGBUILD. 2022-03-03 21:49:10 -03:00
Alexandre Arnt
7ff4a64039 - Added a "-checkupdates" parameter to Notifier, so users can update the
status of an already running Octopi Notifier.
2022-03-03 19:15:11 -03:00
Alexandre Arnt
62127f516f - Remove unused code. 2022-03-03 15:02:36 -03:00
Alexandre Arnt
2b7eead911 Updated translations 2022-03-03 14:52:33 -03:00
Alexandre Arnt
45edde8688 - Made Octopi compatible with aurweb 6.x version (vote/unvote/list AUR). 2022-03-02 12:42:27 -03:00
Alexandre Arnt
e238e4cdd0 - AurVote testing code. 2022-03-01 17:48:59 -03:00
Alexandre Arnt
aa86dff054 - Fixed PKGBUILD and PKGBUILD diff options. 2022-03-01 17:42:56 -03:00
Alexandre Arnt
e5c7c85c81 Merge pull request #507 from glls/master
Make curl follow redirect (301) for news feed
2022-02-06 10:26:09 -03:00
George Litos
040730e9a4 Make curl follow redirect (301) for news feed 2022-02-04 14:45:13 +02:00
Alexandre Arnt
76a4ac7874 Updated translations 2022-01-31 13:59:40 -03:00
Alexandre Arnt
44a14d8eb1 Merge pull request #505 from vnepogodin/master
🔥 Add cachyos support
2022-01-18 10:21:54 -03:00
Vladislav Nepogodin
d6db207676 🔥 add cachyos support 2022-01-17 20:40:56 +04:00
Alexandre Arnt
6dd83e5e53 - Added xdg-open option on editFile(). 2021-12-22 18:37:01 -03:00
Alexandre Arnt
f0ee8c6e03 Updated translations 2021-12-18 09:08:32 -03:00
Alexandre Arnt
91eff99690 - BugFix: "View Outdated" option was not being disabled while Octopi was
executing a transaction.
2021-12-18 09:03:48 -03:00
Alexandre Arnt
7cd3f9b96a - BugFix: editFile() caused a crash while in Mate desktop. Both "Open
PKGBUILD" and "Show PKGBUILD diff" options were affected.
2021-12-16 19:23:16 -03:00
Alexandre Arnt
ce98289abd - Another dev cycle begins;
- BugFix: Pressing ENTER over an installed AUR pkg no longer sends it to
the install action treeview;
- Added "Outdated" filter/option on menu "View";
2021-12-12 10:34:17 -03:00
Alexandre Arnt
d3a6e85c68 - Removed stylesheet from treeviews. It makes dark themes look better. 2021-11-28 10:16:27 -03:00
Alexandre Arnt
74b4a79974 Merge pull request #499 from buckmelanoma/add_options_icon
Add getIconOptions icon for Options menu
2021-11-28 10:08:29 -03:00
buckmelanoma
79f5d61972 Typo fix 2021-11-21 16:42:44 -08:00
Buck Melanoma
b974aff871 Add getIconOptions icon for Options menu 2021-11-21 16:38:55 -08:00
Alexandre Arnt
31980010af Updated CHANGELOG 2021-11-06 18:31:12 -03:00
Alexandre Arnt
6fd963066f Preparation for 0.12.0 release 2021-11-06 17:46:23 -03:00
Alexandre Arnt
f5b16db539 Octopi-sudo code was synced to match project lxqt-sudo version 1.0.0. 2021-11-06 14:57:53 -03:00
Alexandre Arnt
cc27dcadec Updated README file 2021-10-24 11:34:31 -03:00
Alexandre Arnt
5170d1658c Merge branch 'master' of https://github.com/aarnt/octopi 2021-10-23 19:59:34 -03:00
Alexandre Arnt
d2ea008331 - Added support for Obarun Linux. 2021-10-23 19:59:18 -03:00
Alexandre Arnt
06cbf74d32 Merge pull request #496 from dr460nf1r3/master
Use Garuda forum announcement feed for distro news
2021-10-19 06:56:03 -03:00
dr460nf1r3
d7330ed2f0 Use Garuda forum announcement feed for distro news 2021-10-19 08:06:14 +02:00
Alexandre Arnt
29525448bc BugFix: Do not call pacman/alpm methods when Octopi is running a
transaction.
2021-10-13 10:20:37 -03:00
Alexandre Arnt
52ba603816 Updated README file 2021-10-12 16:17:29 -03:00
Alexandre Arnt
173d7f08ef Updated README file 2021-10-12 16:16:41 -03:00
Alexandre Arnt
733b4abdb5 Updated README file 2021-10-12 16:03:22 -03:00
Alexandre Arnt
7572eb55f2 - Small change on openFile method. 2021-10-12 11:40:14 -03:00
Alexandre Arnt
97d9f23d5a - Disable devel param when used AUR tool is paru. 2021-10-12 10:59:16 -03:00
Alexandre Arnt
c4feb158a8 - AUR check changes. 2021-10-09 21:59:03 -03:00
Alexandre Arnt
539b708460 - BugFix: if distro news url settings is empty, let's populate with
correct news site.
2021-10-07 20:20:44 -03:00
Alexandre Arnt
6e0ba4db3b Merge branch 'master' of https://github.com/aarnt/octopi 2021-10-02 11:16:24 -03:00
Alexandre Arnt
a8628f05d8 - Another try on Garuda Linux guessing code. 2021-10-02 11:16:07 -03:00
Alexandre Arnt
05eda76963 Merge pull request #492 from IceCryptonym/paru-fix
Fix Paru "no packages match search"
2021-09-27 21:34:55 -03:00
IceCryptonym
0df51acc45 Fix Paru "no packages match search" 2021-09-27 09:29:11 +10:00
Alexandre Arnt
0d8fbdfa18 README fix 2021-09-19 09:25:46 -03:00
Alexandre Arnt
09e654469f - Added support for Archcraft OS. 2021-09-19 09:23:54 -03:00
Alexandre Arnt
b24e82c0ca README typo 2021-09-18 10:32:23 -03:00
Alexandre Arnt
fbc98fcf92 - README update. 2021-09-18 10:31:29 -03:00
Alexandre Arnt
7bd9c32887 - Added support for Garuda Linux distro. 2021-09-18 10:00:52 -03:00
Alexandre Arnt
d8ce53ef5c - BugFix: Initial database searches are executed after main interface is
shown. This improves UI feedback on older cpus.
2021-09-04 10:48:04 -03:00
Alexandre Arnt
0fe112410c - Actions tab shows a counter feedback for inserts (with a plus signal)
and removals (with a minus signal) and does not steal focus anymore.
2021-09-04 09:50:07 -03:00
Alexandre Arnt
7bb69677ab - BugFix: removed buggy string. 2021-08-21 08:28:01 -03:00
Alexandre Arnt
33b937e082 Updated translations 2021-07-03 11:47:52 -03:00
Alexandre Arnt
25de491e20 - Removed string bugs in parser with pacman 6.0. 2021-07-03 09:37:51 -03:00
Alexandre Arnt
22a0fcbb90 - BugFix in pacman version test.
- BugFix in parser while removing pkgs.
2021-06-19 10:26:04 -03:00
Alexandre Arnt
f063177f2c - More parser fixes for pacman 6.0. 2021-06-06 11:07:57 -03:00
Alexandre Arnt
794c27c4c9 - BugFix: checkupdates (from pacman-contrib 1.4.0) was not outputing a
<BR> to separate new lines.
2021-06-06 10:31:27 -03:00
Alexandre Arnt
f5b9270bbd - Added parser support for pacman 6.0. 2021-06-03 15:23:43 -03:00
Alexandre Arnt
7c35dfd845 Updated translations 2021-05-29 08:40:31 -03:00
Alexandre Arnt
c87555e0be - BugFix: IgnorePkg pkgs are shown as outdated when using ALPM backend. 2021-05-23 11:19:17 -03:00
Alexandre Arnt
f483aa60f7 - Synced with LXQt-sudo code. 2021-04-15 11:09:17 -03:00
Alexandre Arnt
fe6dee7723 - BugFix: If options dialog was called while both notifier and octopi
were running, Updates tab was not shown.
2021-04-05 16:55:02 -03:00
Alexandre Arnt
bfc98aebdb Updated translations 2021-03-30 15:14:18 -03:00
Alexandre Arnt
baa7259340 Updated translations 2021-03-26 14:58:52 -03:00
Alexandre Arnt
1c59c599c7 - Commented uneeded watcher disconnect. 2021-03-17 16:03:17 -03:00
Alexandre Arnt
8f1ca44eb2 Updated translations 2021-03-11 10:49:08 -03:00
Alexandre Arnt
1dffe7e231 Merge branch 'master' of https://github.com/aarnt/octopi 2021-03-09 12:54:51 -03:00
Alexandre Arnt
1998da1cf0 Updated translations. 2021-03-09 12:54:32 -03:00
Alexandre Arnt
085e9be8ae Merge pull request #477 from luis-pereira/readability
Readability
2021-03-05 17:29:21 -03:00
Alexandre Arnt
c0ffbf1422 Updated translations 2021-02-27 17:57:32 -03:00
Luís Pereira
900d49c227 Simplify logic expressions (continued)
Done by hand. Clazy didn't fixit.
2021-02-17 16:24:02 +00:00
Luís Pereira
8bb9ebc512 Simplify logic expressions
Much cleaner code. Done by clang-tidy.
2021-02-16 17:21:37 +00:00
Luís Pereira
3f47c2127c Use the empty method to test for emptiness
Much more readable than size == 0.
2021-02-15 19:56:03 +00:00
Luís Pereira
f0a7fef072 Don't check against nullptr before delete
It's fine to delete a null pointer.
2021-02-15 19:41:49 +00:00
Alexandre Arnt
16fd585d2e Merge pull request #474 from luis-pereira/use-qstring-multi-arg
Use QString multi arg
2021-02-12 10:01:36 -03:00
Luís Pereira
5469925a40 Use QString multi arg
Less memory allocations.
2021-02-10 18:29:58 +00:00
Alexandre Arnt
c9f21b2d5c PKGBUILD updated; Removed install file. 2021-02-10 13:46:25 -03:00
Alexandre Arnt
d6a6ecc504 - BugFix: Alpm related compilation error. 2021-02-10 10:57:47 -03:00
Alexandre Arnt
c900d85241 Updated translations 2021-02-08 15:26:42 -03:00
Alexandre Arnt
80508a3df4 updated changelog 2021-02-06 17:07:16 -03:00
Alexandre Arnt
f98f74447b Updated README 2021-02-06 16:27:29 -03:00
Alexandre Arnt
2909208e97 - Completed aur rpc search code (testing only). 2021-02-06 16:20:48 -03:00
Alexandre Arnt
30b938cc17 - Test code for retrieving AUR pkgs using https/rpc api (not working
100% and slower than aur helpers)
2021-02-05 19:12:06 -03:00
Alexandre Arnt
a63d970ae3 - Updated octopi-sudo readme. 2021-02-05 16:03:18 -03:00
Alexandre Arnt
622c041e3b - Method name/variables refactorings 2021-02-05 15:52:47 -03:00
Alexandre Arnt
a96ad4190b - Refactored KaOS/KCP pkg search code. 2021-02-05 14:53:09 -03:00
Alexandre Arnt
c503c6cce0 - Another step in completing Paru support. 2021-02-05 10:42:43 -03:00
Alexandre Arnt
1234d31bc6 - BugFix: If user went from AUR to normal search with a not found pkg
the statusbar counters would become invisible.
2021-01-31 12:28:19 -03:00
Alexandre Arnt
46ac37fc4a - Added support for opendoas tool (default). 2021-01-31 11:44:47 -03:00
Alexandre Arnt
c4739bd5c9 - Small refactor due to clazy feedback. 2021-01-30 23:56:09 -03:00
Alexandre Arnt
ac0ee5df2f - Added initial support for Paru AUR tool;
- Some refactorings due to clazy feedback.
2021-01-30 23:51:29 -03:00
Alexandre Arnt
3f5594e143 - Another dev cycle begins... 2021-01-30 21:39:49 -03:00
Alexandre Arnt
224665bf29 - BugFix: Get rid of unused variable. 2021-01-29 09:46:53 -03:00
Alexandre Arnt
ac2990ab15 Merge pull request #472 from luis-pereira/perf-for-range-loop
Perf for range loop
2021-01-29 09:28:45 -03:00
Luís Pereira
84ebf2d239 Avoid container detachment in range for loops - Part 2
* Make container const
* Use qAsConst()

Done manually.
2021-01-28 17:04:19 +00:00
Luís Pereira
d4289dc66b Avoid container detachment in range for loops - Part 1
Use qAsConst() to prevent implicitly-shared Qt containers from detaching.
Done by clazy fixit.
2021-01-28 17:04:18 +00:00
Luís Pereira
d0bed2979a Use const references in ranged for loop variables
They are copied but only used as const references.
Performance improvement.
2021-01-28 17:04:08 +00:00
Alexandre Arnt
d128b0e8ac Merge pull request #469 from luis-pereira/use-const-references
Use const reference where possible
2021-01-27 14:43:42 -03:00
Luís Pereira
698423dba9 Use const reference where possible
It increases performance.
2021-01-25 19:54:10 +00:00
Alexandre Arnt
2ee7414b0e Merge pull request #468 from luis-pereira/use-nullptr
Use C++11 nullptr
2021-01-22 14:51:29 -03:00
Luís Pereira
b49b52a26a Use C++11 nullptr 2021-01-22 12:49:03 +00:00
Alexandre Arnt
f147678491 Updated CHANGELOG 2021-01-11 12:59:30 -03:00
Alexandre Arnt
5b8dfb0388 - Removed unused parameters from Octopi's main project file. 2021-01-11 12:25:47 -03:00
Alexandre Arnt
50e1c6bb85 - Release preparation... 2021-01-11 11:24:50 -03:00
Alexandre Arnt
4805a95ff8 - Updated translation. 2021-01-08 15:17:46 -03:00
Alexandre Arnt
c5688495c0 - BugFix: Clicking on printed outdated packages in Output tab did not
send to corresponding package in the main list after a 'Check updates'.
2021-01-06 21:57:57 -03:00
Alexandre Arnt
400c4750fd - Removed unneeded code. 2021-01-06 21:30:41 -03:00
Alexandre Arnt
ab8af8bc6e - Refactorings to decouple some logic. 2021-01-06 19:00:49 -03:00
Alexandre Arnt
bb06f38da9 Merge branch 'master' of https://github.com/aarnt/octopi 2021-01-02 10:21:42 -03:00
Alexandre Arnt
7f15a34bc9 - Updated translations. 2021-01-02 10:21:34 -03:00
Alexandre Arnt
8e9e0d05e9 Update README.md 2020-12-30 19:05:25 -03:00
Alexandre Arnt
a85d8af58f Update README.md 2020-12-30 19:04:50 -03:00
Alexandre Arnt
241f9e7241 - Supress buggy string in parser. 2020-12-22 15:41:30 -03:00
Alexandre Arnt
b5fda06f3e - BugFix: Prevent icon changes in notifier when there were transaction
errors.
2020-12-22 14:50:26 -03:00
Alexandre Arnt
ded5f7313a Updated translations. 2020-12-22 10:21:32 -03:00
Alexandre Arnt
cda6193af7 Updated translations 2020-12-21 11:55:24 -03:00
Alexandre Arnt
d23117a714 - Remove www from Arch url;
- Updated translations.
2020-12-19 17:44:51 -03:00
Alexandre Arnt
226d0425c4 - Small refactor. 2020-12-17 16:51:31 -03:00
Alexandre Arnt
70d6220f4e - BugFix: WM detection now uses "ps -aux";
- Updated translations.
2020-12-17 10:06:19 -03:00
Alexandre Arnt
a6349334a1 Updated translations 2020-12-11 09:47:07 -03:00
Alexandre Arnt
9f228d393a - Updated translations. 2020-12-10 16:20:48 -03:00
Alexandre Arnt
8599400779 - Updated translations. 2020-12-10 11:08:16 -03:00
Alexandre Arnt
eef29fb556 - String fix. 2020-12-08 11:03:36 -03:00
Alexandre Arnt
773caf0e0c - Prevent users from running Octopi, Notifier and Cache Cleaner outside
"/usr/bin" dir.
2020-12-07 13:34:45 -03:00
Alexandre Arnt
70f1445df5 Merge branch 'master' of https://github.com/aarnt/octopi 2020-12-01 18:55:54 -03:00
Alexandre Arnt
d35f3759a9 Removed service target 2020-12-01 18:55:07 -03:00
Alexandre Arnt
590c4143e1 Update CHANGELOG
Fixed typo
2020-11-30 18:41:07 -03:00
Alexandre Arnt
42e8e4ed2b - Bugfix in flag initialization. 2020-11-30 15:56:25 -03:00
Alexandre Arnt
6563139418 - BugFix: Disable Info/Files tab refresh while typing in filter/search
line edit.
2020-11-30 15:15:14 -03:00
Alexandre Arnt
6209e80e4c - Whenever user selects "Check updates" in notifier and octopi is
running, octopi processes the request.
2020-11-29 11:03:15 -03:00
Alexandre Arnt
5e1e70666e Updated screenshot 2020-11-29 10:23:39 -03:00
Alexandre Arnt
4c93c474ff - BugFix: disable "change install reason option" while in transaction;
- Disable stop button after post-download phase in pacman.
2020-11-29 10:10:23 -03:00
Alexandre Arnt
e5ef5085e5 - BugFix: KaOS fixes to kcp search and install.
- BugFix: Statusbar showed a number of packages when the list was empty
(the previous value).
2020-11-27 17:44:28 -03:00
Alexandre Arnt
3b94072502 - Reverted changes in open PKGBUILD methods;
- Keep open PKGBUILD options enabled while building packages.
2020-11-26 11:22:56 -03:00
Alexandre Arnt
535c70e695 - Trying to use another download method in open PKBUILD/diff. 2020-11-25 18:48:29 -03:00
Alexandre Arnt
0d1a835f66 - Added support to gedit in editFile method. 2020-11-25 16:38:52 -03:00
Alexandre Arnt
36f5c818d1 - Refactorings in propertiestabwidget calls and openfile code. 2020-11-25 12:06:08 -03:00
Alexandre Arnt
e8794007d6 - Updated CHANGELOG. 2020-11-25 11:24:44 -03:00
Alexandre Arnt
033b327ee6 - Refactorings for AUR based variable names. 2020-11-25 10:49:14 -03:00
Alexandre Arnt
9258b3a252 - Added support to build multiple foreign packages at the same time
(they are first copied to the Actions' tree view just like official
packages).
2020-11-24 20:13:04 -03:00
Alexandre Arnt
beb8d45dac - Some small refactorings. 2020-11-23 19:08:32 -03:00
Alexandre Arnt
34d38280ff - Another try to fix terminal issues while in AUR. 2020-11-23 12:32:24 -03:00
Alexandre Arnt
e553367f22 - Fixed some crashes from previous changes. 2020-11-20 18:59:30 -03:00
Alexandre Arnt
a7cf805cda - BugFix: If you tried to execute octopi after upgrading your system
with notifier you got a notifier crash and an octopi freeze (thanks to
linuxer for pointing that out).
2020-11-16 19:57:51 -03:00
Alexandre Arnt
fd1b3516f4 - Added "Open news in a browser" option on right clicking the News tab. 2020-11-15 10:58:51 -03:00
Alexandre Arnt
6e05037eb9 - Added a red border in the AUR warning rectangle;
- Removed unused code in optionsdialog.cpp.
2020-11-11 18:32:30 -03:00
Alexandre Arnt
5845f49b79 Updated screenshot 2020-11-11 17:59:54 -03:00
Alexandre Arnt
d7c2d23dfa - Removed unused code. 2020-11-11 12:42:34 -03:00
Alexandre Arnt
6bebce8693 - BugFix: Removed tab focus from stop transaction button. 2020-11-11 12:29:42 -03:00
Alexandre Arnt
483bdf85e1 - BugFix: Removed tab focus from "outdated" buttons at statusbar. 2020-11-11 12:25:44 -03:00
Alexandre Arnt
4ae0c6f436 - BugFix: "total download size" showed the value 0 in Notifier if the
database was not synched.
2020-11-11 12:15:44 -03:00
Alexandre Arnt
3da5a4eac5 - BugFix: Tab navigation improvements. 2020-11-10 19:40:26 -03:00
Alexandre Arnt
83087072c2 - Updated getPackageSize code. 2020-11-10 15:09:03 -03:00
Alexandre Arnt
268dea6272 - Removed unused test. 2020-11-10 12:29:27 -03:00
Alexandre Arnt
b966faa0dd - Added "Depends On" and "Make Deps" fields at Info tab while in AUR
mode.
2020-11-10 12:15:31 -03:00
Alexandre Arnt
2f96f12386 - Added support for '^' and '$' chars in AUR search. 2020-11-10 11:06:29 -03:00
Alexandre Arnt
3e50690e0c - BugFix in Open PKGBUILD/Show PKGBUILD diff with "Package base" code. 2020-11-08 22:22:42 -03:00
Alexandre Arnt
c53774609b - Added "Show PKGBUILD diff" option to show the differences between latest
and previous PKGBUILD files of the selected AUR package in a text editor.
2020-11-08 10:38:48 -03:00
Alexandre Arnt
e3f626da8f - Removed unused code. 2020-11-07 19:27:00 -03:00
Alexandre Arnt
ce1821f8dd - Added "Open PKGBUILD" option to open the AUR PKGBUILD file in a text
editor.
2020-11-07 19:12:53 -03:00
Alexandre Arnt
ecc737d336 - Updated searchlineedit style for not found itens while in KaOS. 2020-11-06 12:10:48 -03:00
Alexandre Arnt
e553a4f045 Merge branch 'master' of https://github.com/aarnt/octopi 2020-11-05 19:59:47 -03:00
Alexandre Arnt
cfb04970a8 - Updated CHANGELOG file. 2020-11-05 19:59:27 -03:00
Alexandre Arnt
bd7d92d18b Merge pull request #457 from Tereius/master
Introduce CMake build system
2020-11-05 19:56:21 -03:00
Alexandre Arnt
cc9811b6de - Updated CHANGELOG file. 2020-11-05 17:12:26 -03:00
Alexandre Arnt
746bb9d7da - Synced octopi-sudo code from lxqt-sudo 0.16.0. 2020-11-05 17:06:15 -03:00
Alexandre Arnt
a3f84b1573 - BugFix in help content. 2020-11-04 19:32:21 -03:00
Alexandre Arnt
7a63e3fc2f - Changed aurvote code to fix an issue. 2020-11-04 18:22:18 -03:00
Alexandre Arnt
885ec83b23 - Debug aurvote code. 2020-11-04 17:10:47 -03:00
Alexandre Arnt
91fdfc8c47 - Another aurvote debug code. 2020-11-04 17:07:18 -03:00
Alexandre Arnt
aa71f64d95 - More debug information in aurvote code. 2020-11-04 16:20:13 -03:00
Alexandre Arnt
188f71b46b - Added "Maintainer", "Last Modified" and "Out-of-date" fields
at Info tab while in AUR mode.
2020-11-03 18:29:23 -03:00
Alexandre Arnt
9825be81b4 - Added "Build directory" option in AUR tab on options dialog, so users
can change where makepkg builds the source code.
2020-10-26 17:53:40 -03:00
Alexandre Arnt
20f4eb2810 - BugFix: Do not permit changing install reason while in AUR mode. 2020-10-25 19:08:51 -03:00
Alexandre Arnt
79a7f4f698 - BugFix: Restored support for command line parameters like "-
sysupgrade-noconfirm" and "-style";
- BugFix: Updated "-help" output text..
2020-10-25 11:10:15 -03:00
Alexandre Arnt
039f98130d - BugFix in pkg version/outdated version. 2020-10-23 20:20:11 -03:00
Alexandre Arnt
c780060214 - Optional package dependencies are now installed with "--asdeps"
parameter.
2020-10-23 19:15:01 -03:00
Alexandre Arnt
a34ba69c24 - Added option to "Change Install Reason" of selected packages
(Explicitly <-> As Dependency).
2020-10-22 18:11:09 -03:00
Alexandre Arnt
af881e7912 - BugFix: Running Notifier within a DE session would lead to a
"Suspicious execution method" error.
2020-10-22 15:10:52 -03:00
Alexandre Arnt
93f3c74a59 - BugFix: Pressing ESC in repoeditor could ask if you wanted to save
your changes even if there were no changes made.
2020-10-20 19:32:36 -03:00
Björn Stresing
db058e35f5 Add Qt5 package min. version check 2020-10-20 19:38:28 +02:00
Björn Stresing
d1347b1820 Update README.md, change install location of octphelper and octopi-sudo 2020-10-20 16:35:34 +02:00
Björn Stresing
33ceb0178f Add missing files to install target, add missing translations 2020-10-17 19:53:13 +02:00
Björn Stresing
baeb542b38 Merge remote-tracking branch 'upstream/master' into master 2020-10-17 18:11:27 +02:00
Alexandre Arnt
fd787a74fc - Faster instant search code. 2020-10-12 15:32:56 -03:00
Alexandre Arnt
e60c516177 - Added a faster refresh package list code after checking for updates;
- Replaced "foreach" for "for".
2020-10-12 14:58:35 -03:00
Alexandre Arnt
b32e94e0ce - BugFix: removed unused code. 2020-10-10 15:29:25 -03:00
Alexandre Arnt
67f6692a48 - Added option to display "Licenses", "Installed Size", "Build Date",
"Install Date" and "Install Reason" columns in the package list;
- Added "Install Date" at Info tab;
- Added "Licenses" at Info tab while in AUR mode.
2020-10-10 15:05:58 -03:00
Alexandre Arnt
0ad770c83e - Striping some unused code. 2020-10-05 12:18:23 -03:00
Alexandre Arnt
05a891b2a6 BugFix: updated wrong path reference. 2020-10-05 10:37:15 -03:00
Alexandre Arnt
a1ed637f31 - Removed string replaces from generated sysinfo file. 2020-10-04 19:24:59 -03:00
Alexandre Arnt
8ae7a0fd8f BugFix: QtSingleApplication class does not like messing with TMPDIR
variable too...
2020-10-04 19:10:42 -03:00
Alexandre Arnt
42064d75df - A new release cycle begins: 0.11 (dev);
- Updated PKGBUILD file following MatMoul's suggestion;
- Removed unused speedup service;
- BugFix: unset TMPDIR environment variable on every Octo tool startup
(to avoid "octopi-helper[aborted]: Couldn't attach to memory" errors).
2020-10-04 18:22:05 -03:00
Björn Stresing
064cb3ded3 Set correct CMake octopi version 2020-10-04 21:58:55 +02:00
Björn Stresing
5d36b8a957 Introduce CMake build system 2020-10-04 21:39:28 +02:00
Alexandre Arnt
f6961a89ca Updated Manjaro news url 2020-07-19 14:40:55 -03:00
Alexandre Arnt
2d9c34fa18 Merge branch 'master' of https://github.com/aarnt/octopi 2020-07-18 19:01:58 -03:00
Alexandre Arnt
aed6d3948a - Updated translations. 2020-07-18 19:01:26 -03:00
Alexandre Arnt
c19a324cda Update README.md
Updated readme file
2020-07-10 09:45:32 -03:00
Alexandre Arnt
614e3b8bd3 - BugFix: Don't let tab 1 and 2 disablement trigger refresh. 2020-07-06 14:26:09 -03:00
Alexandre Arnt
a575a04981 - Use space key to refresh info and tab files and restrict auto
refreshing info tab.
2020-07-03 19:43:44 -03:00
Alexandre Arnt
b4899bcedc - RefreshTabInfo code update. 2020-07-03 19:07:18 -03:00
Alexandre Arnt
e159abaafc Merge branch 'master' of https://github.com/aarnt/octopi 2020-07-02 17:16:08 -03:00
Alexandre Arnt
e55090a066 - BugFix in tab files refresh;
- QRegularExpression fixes.
2020-07-02 17:15:25 -03:00
Alexandre Arnt
ec89b8a2bc Update README.md 2020-07-02 13:43:36 -03:00
Alexandre Arnt
95faab97a9 - Release preparation. 2020-07-01 18:05:26 -03:00
Alexandre Arnt
a7108f0835 - Updated README.md file. 2020-07-01 17:24:55 -03:00
Alexandre Arnt
48bf47fa48 - BugFix: checks for octopi-sudo in main before execution. 2020-06-29 11:25:10 -03:00
Alexandre Arnt
2a5f9b32b6 - Updated supported Linux readme. 2020-06-29 11:11:22 -03:00
Alexandre Arnt
208f689118 - BugFix with AUR debuging timer. 2020-06-28 23:10:00 -03:00
Alexandre Arnt
f7f34a6562 - BugFix in AUR/optionsdialog. 2020-06-28 22:30:54 -03:00
Alexandre Arnt
ad8732ef81 - Added support for Artix Linux news. 2020-06-28 21:58:18 -03:00
Alexandre Arnt
b432c40c26 - Initial support to Artix Linux. 2020-06-28 14:22:18 -03:00
Alexandre Arnt
3d1b4678bc - BugFix in menuRepository action;
- Initial Artix Linux support.
2020-06-28 14:12:14 -03:00
Alexandre Arnt
363374f639 - Updated translations. 2020-06-25 17:03:01 -03:00
Alexandre Arnt
8141393314 - Get tabs 1 and 2 locked during actions. 2020-06-24 15:40:19 -03:00
Alexandre Arnt
76330f8b17 - Enable a more complete UI lockdown during transactions;
- BugFix: Enable "Find a file" context menu option on a non installed
pkg.
2020-06-24 12:12:36 -03:00
Alexandre Arnt
7da9c3edc0 - Added "xdg-open" to the openFile() possibilities. 2020-06-24 10:07:31 -03:00
Alexandre Arnt
f5b22fba98 - Code update due to Qt 5.15 version. 2020-06-22 21:54:16 -03:00
Alexandre Arnt
8defc3bdd0 - Small refactoring in wmhelper code. 2020-06-13 18:25:08 -03:00
Alexandre Arnt
71238d3e93 - Updated translations. 2020-06-13 15:48:24 -03:00
Alexandre Arnt
121ad0d634 - BugFix: Notifier was not detaching shared memory when pinged from
helper;
- Removed unused code.
2020-06-13 14:43:08 -03:00
Alexandre Arnt
ad28a0678f - BugFix in wmhelper.cpp with Qt 5.15. 2020-06-12 14:11:58 -03:00
Alexandre Arnt
3db8415077 - Huge batch of changes due to Qt5 5.15 release. ***Testing needed!*** 2020-06-12 13:55:02 -03:00
Alexandre Arnt
6c3b63f98f - Added option to change terminal's color scheme, font family and font
size through ~/.config/octopi/octopi.conf;
- BugFix in outdated aur statusbar button.
2020-05-26 17:03:39 -03:00
Alexandre Arnt
f3a14edab0 - Reverted some code for bug fixing. 2020-05-24 11:43:34 -03:00
Alexandre Arnt
043931eb2a - Yaourt is no more... 2020-05-22 17:59:08 -03:00
Alexandre Arnt
1c578367b7 - Reverted some changes to fix some user crashes. 2020-05-22 17:00:00 -03:00
Alexandre Arnt
28e4c0f989 - Updated code for refreshAppIcon after a outputdialog close;
- Updated translation;
2020-05-21 17:22:43 -03:00
Alexandre Arnt
46535831d3 - Reverted change: Let's not toy with established things. 2020-05-20 15:57:22 -03:00
Alexandre Arnt
d1048abc9f - BugFix: Defer building of outdated, unrequired and foreign pkg lists
after mainwindow pops on the screen.
2020-05-20 15:04:50 -03:00
Alexandre Arnt
8dcc30ca9e - Fixed octopi-sudo version. 2020-05-17 23:06:05 -03:00
Alexandre Arnt
b87ed8345b - BugFix in parser. 2020-05-16 16:52:54 -03:00
Alexandre Arnt
4b3507539c - Enhances AUR code at getOutdatedAURList;
- BugFix in pikaur code.
2020-05-02 19:57:38 -03:00
Alexandre Arnt
6008d37c19 - Another AurVote try... 2020-05-02 12:20:47 -03:00
Alexandre Arnt
6b601439cc - Show AurVote debug info to help users with AUR login issues. To enable
just run Octopi as: "/usr/bin/octopi -d".
2020-05-02 11:51:09 -03:00
Alexandre Arnt
0dad821102 - Added option "--devel" in AUR tab to check for newer versions of dev
packages;
2020-04-27 20:34:18 -03:00
Alexandre Arnt
739397211e Updated txs 2020-04-27 15:29:45 -03:00
Alexandre Arnt
5bb1faa43b - Fixed buggy str in parser. 2020-04-25 17:18:31 -03:00
Alexandre Arnt
524f305cc2 - Merge octopi-sudo code with lxqt-sudo changes;
- Fixed compilation error;
2020-04-25 15:07:36 -03:00
Alexandre Arnt
c56d777c96 - Removed another buggy str in parser. 2020-04-19 21:44:04 -03:00
Alexandre Arnt
8e8decae26 - Removed buggy string in parser;
- Code clean;
2020-04-19 21:25:33 -03:00
Alexandre Arnt
e727c8e598 - Updated translations. 2020-04-04 21:27:40 -03:00
Alexandre Arnt
275d159d81 Merge pull request #439 from luis-pereira/notifier-drop-foreach
Drop Qt foreach
2020-04-04 21:24:01 -03:00
Alexandre Arnt
a2802044a6 Merge pull request #438 from luis-pereira/helper-drop-foreach
Drop Qt foreach
2020-04-04 21:22:27 -03:00
Luís Pereira
218f27bce0 Drop Qt foreach
Use C++11 range for loop. foreach will be removed from Qt.
2020-04-03 16:37:44 +01:00
Luís Pereira
10c97c96c3 Drop Qt foreach
Use C++11 range for loop. foreach will be removed from Qt.
2020-04-02 18:51:30 +01:00
Alexandre Arnt
0066009d11 Updated PKGBUILD 2020-04-01 18:54:13 -03:00
Alexandre Arnt
e46899b4f5 - Set COLORTERM and TERM variables for qtermwidget in octopi and
notifier.
2020-04-01 15:51:09 -03:00
Alexandre Arnt
ed61820026 BugFix: AUR upgrades in notifier were not setting m_commandExecuting flag. 2020-04-01 15:29:14 -03:00
Alexandre Arnt
3db8927f28 - Updated CHANGELOG. 2020-03-30 19:31:29 -03:00
Alexandre Arnt
1eff031e23 - BugFix: Default to remove AUR packages using pacman -R (thanks to
mputterf).
2020-03-30 19:20:06 -03:00
Alexandre Arnt
e2c87e2c50 - Fixed wrong project site on PKGBUILD and Help tab (thanks to
simonbcn);
- Updated translations.
2020-03-30 18:14:36 -03:00
Alexandre Arnt
58797754eb Merge pull request #430 from luis-pereira/delete-nullptr
Don't check for nullptr before delete
2020-03-29 19:02:45 -03:00
Alexandre Arnt
88590ec964 Merge pull request #429 from luis-pereira/modernize
Modernize
2020-03-29 19:02:16 -03:00
Luís Pereira
c770253981 Don't check for nullptr before delete
It's fine to delete a nullptr pointer.
Improves readability.
2020-03-26 16:29:43 +00:00
Luís Pereira
67dc305cc9 Use equals delete
Mark unimplemented private special member functions with = delete.
Done by clang-tidy.
2020-03-25 15:37:15 +00:00
Luís Pereira
a4454951e4 Use bool literals
Finds integer literals which are cast to bool.
Done by clang-tidy.
2020-03-25 15:18:41 +00:00
Luís Pereira
4fdcb953e8 Port towards C++ headers
Done by clang-tidy.
2020-03-25 14:29:24 +00:00
Luís Pereira
11e437b5b5 Port towards C++11 nullptr
Done by clang-tidy.
2020-03-25 13:21:54 +00:00
Alexandre Arnt
3dc3fa73ec - Updated CHANGELOG. 2020-03-24 20:16:15 -03:00
Alexandre Arnt
dad4f38804 Merge branch 'master' of https://github.com/aarnt/octopi 2020-03-24 19:36:00 -03:00
Alexandre Arnt
bb0bc7b3f2 - Updated translations. 2020-03-24 19:35:05 -03:00
Alexandre Arnt
46ef3655c1 Merge pull request #428 from luis-pereira/strict-iterators
Don't mix const and non const iterators
2020-03-24 19:22:08 -03:00
Alexandre Arnt
11010fbf23 Merge pull request #427 from luis-pereira/sudo-string-casts
sudo: Don't use implicit string conversions
2020-03-24 19:21:38 -03:00
Alexandre Arnt
af1d5829c9 Merge pull request #426 from luis-pereira/repoeditor-string-casts
repoeditor: Don't use implicit string conversions
2020-03-24 19:19:50 -03:00
Alexandre Arnt
abccec8324 Merge pull request #425 from luis-pereira/notifier-string-casts
notifier: Don't use implicit string conversions
2020-03-24 19:18:53 -03:00
Alexandre Arnt
70b36e25df Merge pull request #424 from luis-pereira/helper-string-casts
helper: Don't use implicit string conversions
2020-03-24 19:15:44 -03:00
Alexandre Arnt
94d368337f Merge pull request #423 from luis-pereira/ccachecleaner-string-casts
ccachecleaner: Don't use implicit string conversions
2020-03-24 19:14:30 -03:00
Luís Pereira
36ffdbaa86 Don't mix const and non const iterators
It prevents detachments but also caches some subtle bugs.
Found by Clazy.
2020-03-24 17:08:36 +00:00
Luís Pereira
ec48262a24 sudo: Don't use implicit string conversions
Enforcing it also.
2020-03-23 22:50:14 +00:00
Luís Pereira
2dd6888d28 repoeditor: Don't use implicit string conversions
Enforcing it also.
2020-03-23 21:57:10 +00:00
Luís Pereira
b21774789d notifier: Don't use implicit string conversions
Enforcing it also.
2020-03-23 18:02:27 +00:00
Luís Pereira
f7f8067263 helper: Don't use implicit string conversions
Enforcing it also.
2020-03-23 16:21:20 +00:00
Luís Pereira
f491a77ee0 ccachecleaner: Don't use implicit string conversions
Enforcing it also.
2020-03-23 14:25:44 +00:00
Alexandre Arnt
0d86bc1e2f - Updated translations. 2020-03-20 19:02:48 -03:00
Alexandre Arnt
cd2cc7045e Merge pull request #422 from luis-pereira/no-implicit-string-casts
No implicit string casts
2020-03-20 18:59:59 -03:00
Luís Pereira
ff65bad532 Don't use implict conversions from QByteArray
Enforce it with QT_NO_CAST_FROM_BYTEARRAY.
2020-03-20 19:26:01 +00:00
Luís Pereira
4a366da7d9 Don't use implict Url conversions from strings
Enforce it with QT_NO_URL_CAST_FROM_STRING.
2020-03-20 19:22:54 +00:00
Luís Pereira
64b143b843 Don't use implicit conversions to ASCII
Enforce it with QT_NO_CAST_TO_ASCII.
2020-03-20 18:53:31 +00:00
Luís Pereira
ff7f108e58 Don't use implicit char to QString conversion, part 2
Make the conversions explicit.
Enforcing it also with QT_NO_CAST_FROM_ASCII.
2020-03-20 17:54:58 +00:00
Luís Pereira
95d8882854 Don't use implicit char to QString conversion, part 1
Reduce the number of unneeded memory allocations.
Make the conversions explicit.
Done automatically by Clazy. The remaining cases will be done by hand.
2020-03-20 17:40:45 +00:00
Alexandre Arnt
fa4451316c Merge pull request #419 from luis-pereira/use-qstring-multi-arg
Don't use chained QString::arg() calls
2020-03-16 22:17:58 -03:00
Alexandre Arnt
1ead404fac Merge pull request #420 from luis-pereira/use-qstring-ref
Use QString::xxxxRef()
2020-03-16 22:17:43 -03:00
Alexandre Arnt
af48197cdc - Updated txs. 2020-03-16 21:46:04 -03:00
Luís Pereira
22c807eb00 Use QString::xxxxRef()
Instead of QString::xxxx(). It avoids temporary heap allocations.
xxxx can be mid, left, right.
Found by clazy.
2020-03-16 19:29:56 +00:00
Luís Pereira
c25660d304 Don't use chained QString::arg() calls
Use the multi-arg overload to save memory allocations.
Found by clazy.
2020-03-16 13:15:24 +00:00
Alexandre Arnt
292506e020 - Updated screenshot. 2020-03-08 17:48:19 -03:00
Alexandre Arnt
dab4844ebe - BugFix: Keep search method selected by the user until Octopi is
closed;
- BugFix: Notifier just upgrades in Octopi if it has outdated pkgs
available.
2020-03-08 17:38:07 -03:00
Alexandre Arnt
cd3df70032 - Updated tx;
- Updated exit icon;
- BugFix: Never disable exit menu.
2020-03-08 10:34:01 -03:00
Alexandre Arnt
6817c63d83 - Simpler code on app close event. 2020-03-07 22:57:43 -03:00
Alexandre Arnt
071d489af0 - Fix for Lumina. 2020-03-07 17:55:42 -03:00
Alexandre Arnt
a433ea673f - Added Lumina desktop support. 2020-03-07 17:20:19 -03:00
Alexandre Arnt
fe0a38b7fc - BugFixes in pacmanExec deletion. 2020-03-06 23:28:23 -03:00
Alexandre Arnt
9e32b7846c - Updated makeURLClickable code. 2020-03-06 21:23:26 -03:00
Alexandre Arnt
ce8eb46a69 - Small fixes in parser;
- No searchbar in default notifier terminal;
- Code cleanups.
2020-03-04 11:57:33 -03:00
Alexandre Arnt
05f3607fb2 - Updated txs. 2020-03-02 11:45:51 -03:00
Alexandre Arnt
99f737e3cc - Updated txs. 2020-02-24 11:16:31 -03:00
Alexandre Arnt
2d0ffd8174 - Updated txs. 2020-02-19 22:33:59 -03:00
Alexandre Arnt
9f7ff44164 - Updated txs. 2020-02-17 12:03:37 -03:00
Alexandre Arnt
316a91d102 - BugFix on F5 code 2020-02-15 18:02:41 -03:00
Alexandre Arnt
000c00b346 - BugFix: Don't let some shortcuts be executed while an action is
running;
- Updated txs.
2020-02-15 16:52:00 -03:00
Alexandre Arnt
fae53c8d6e - Updated txs. 2020-02-10 21:31:35 -03:00
Alexandre Arnt
23c0ada511 - Updated translation. 2020-02-07 19:19:41 -03:00
Alexandre Arnt
a812cf5316 - Reverting link color hard coding. We can configure themes to change
anything.
2020-02-07 19:10:23 -03:00
Alexandre Arnt
6742daf14c - Updated searchlineedit.cpp 2020-02-06 20:06:05 -03:00
Alexandre Arnt
61b77290fe - Updated icons. 2020-02-06 19:57:12 -03:00
Alexandre Arnt
6a0a8002d9 - Reverting... 2020-02-06 19:02:33 -03:00
Alexandre Arnt
5d49c4bd96 - Change searchlineedit behaviour on plasma. 2020-02-06 18:46:55 -03:00
Alexandre Arnt
1072a3612f - Added espace at the end of output pkg lists. 2020-02-06 18:18:29 -03:00
Alexandre Arnt
3fece6a554 - Updated translations. 2020-02-06 18:04:47 -03:00
Alexandre Arnt
d459833b44 - Updated translations. 2020-02-06 12:45:13 -03:00
Alexandre Arnt
0f217461a2 - bugfix in searchlineedit code. 2020-02-06 12:18:42 -03:00
Alexandre Arnt
926c7ef117 - Removed useless img. 2020-02-06 12:04:09 -03:00
Alexandre Arnt
9f90ed5f76 - BugFix: scroll problems with some themes. 2020-02-06 11:36:43 -03:00
Alexandre Arnt
ca6826b3d7 - Updated screenshot. 2020-02-06 10:56:30 -03:00
Alexandre Arnt
846615374f - Changed searchlineedit style. 2020-02-06 01:22:59 -03:00
Alexandre Arnt
e9e7ca3df8 - Updated hyperlink color. 2020-02-05 23:42:31 -03:00
Alexandre Arnt
cf7e52d71e - Changed hyperlink color to green. 2020-02-05 22:58:01 -03:00
Alexandre Arnt
1f384616c7 - Updated translations. 2020-02-05 21:46:59 -03:00
Alexandre Arnt
8b99edab3e - Updated translations. 2020-02-02 10:29:11 -03:00
Alexandre Arnt
10f7c2307c -Updated translations. 2020-02-01 19:06:21 -03:00
Alexandre Arnt
505621cc6d - BugFix in has changes check. 2020-01-29 17:16:00 -03:00
Alexandre Arnt
d9f6e6da92 - Remove unused class. 2020-01-29 16:34:24 -03:00
Alexandre Arnt
a05add18cd - Updated translations. 2020-01-28 10:58:50 -03:00
Alexandre Arnt
fd5dcc07fa - Updated translations. 2020-01-25 20:12:25 -03:00
Alexandre Arnt
f67e3f27e8 - Updated translations. 2020-01-21 19:27:30 -03:00
Alexandre Arnt
b838d2fa26 - Compile fix and internet check fix. 2020-01-21 19:10:24 -03:00
Alexandre Arnt
e846990877 - Fixed proxy settings on helper. 2020-01-17 17:30:08 -03:00
Alexandre Arnt
2250904a90 - Introduction of proxy usage support. 2020-01-17 17:02:39 -03:00
Alexandre Arnt
6500cb9e2e - Updated helper test code. 2020-01-15 21:46:03 -03:00
Alexandre Arnt
66311c1f4d - Use msg with bold. 2020-01-15 14:49:40 -03:00
Alexandre Arnt
dd261f4ed2 - Improved output messages on installing yay-bin package. 2020-01-15 14:24:08 -03:00
Alexandre Arnt
0d2ea072ca - Removed unused code. 2020-01-14 22:03:27 -03:00
Alexandre Arnt
c6293bf567 - Commented test code. 2020-01-13 22:51:33 -03:00
Alexandre Arnt
622631bb1c - Updated translation;
- Fixed cancel actions on exit code.
2020-01-13 22:47:08 -03:00
Alexandre Arnt
5438954d7c - Fixed cache-cleaner shared mem code;
- Add stopTransaction return code to fix wrong behaviour.
2020-01-12 12:32:21 -03:00
Alexandre Arnt
7931b5f626 - Show QtermWidget search box on notifier's AUR upgrades;
- BugFix: Make notifier code consistent with AUR upgrades;
2020-01-12 11:09:56 -03:00
Alexandre Arnt
a32d8c6193 - Updated README.md file. 2020-01-11 20:35:13 -03:00
Alexandre Arnt
2cde060e2f - BugFix: Disable Notifier menu actions while upgrading. 2020-01-11 17:23:27 -03:00
Alexandre Arnt
64e82a2f34 - Added ko and tr translations. 2020-01-11 15:35:12 -03:00
Alexandre Arnt
0d322a718e - Notifier: Let escape key be recognized on terminal while upgrading
packages.
2020-01-11 10:50:18 -03:00
Alexandre Arnt
00e3ee492f - Updated translations;
- Updated sharedmem code cleanup code;
- Updated octo tools cross checks.
2020-01-11 10:19:55 -03:00
Alexandre Arnt
da2f616509 - Changes in notifier sharedmem code. 2020-01-11 00:18:45 -03:00
Alexandre Arnt
81fbb39c35 - Fixes in SharedMem code. 2020-01-10 23:13:54 -03:00
Alexandre Arnt
2334d2684e - Add some testing code. 2020-01-08 23:39:56 -03:00
Alexandre Arnt
63bb50a602 - Updated translations. 2020-01-08 22:19:55 -03:00
Alexandre Arnt
e187d54d0b - Updated translations. 2020-01-06 21:23:31 -03:00
Alexandre Arnt
26029b124d - Updated project site on about dialog. 2020-01-06 21:21:52 -03:00
Alexandre Arnt
4dc4a42570 - Updated pkg extension support. 2020-01-06 21:15:14 -03:00
Alexandre Arnt
69706789e2 - Removed fixed size font from info tab code. 2020-01-04 22:06:50 -03:00
Alexandre Arnt
337dc296ac - Updated screenshot. 2020-01-04 21:52:02 -03:00
Alexandre Arnt
fddcbc72b5 - Updated CHANGELOG. 2020-01-04 21:45:45 -03:00
Alexandre Arnt
c6a5028306 - Updated icon file. 2020-01-04 16:48:10 -03:00
Alexandre Arnt
791cc24d1e - Added specific icon for foreign non installed pkg. 2020-01-04 16:11:03 -03:00
Alexandre Arnt
b741c49f2d - Add code to print dotpacnew file list summary on notifier (if any). 2020-01-04 15:23:04 -03:00
Alexandre Arnt
8b83830c15 - Print .pacnew list summary after upgrade. 2020-01-04 14:57:37 -03:00
Alexandre Arnt
c4cec0b122 - Updated translations. 2020-01-04 14:00:50 -03:00
Alexandre Arnt
74a519472a - Updated translations. 2020-01-04 09:39:04 -03:00
Alexandre Arnt
e452f82542 - Some icon changes. 2020-01-04 09:17:33 -03:00
Alexandre Arnt
c67771698a - Updated README.md file. 2020-01-03 21:37:33 -03:00
Alexandre Arnt
fa9f4ce1c7 - Updated PKGBUILD file. 2020-01-03 17:29:48 -03:00
Alexandre Arnt
c0538bd1ba - Updated translations. 2020-01-03 16:54:04 -03:00
Alexandre Arnt
6a91e57b58 - Updated repoeditor translations. 2020-01-02 22:54:39 -03:00
Alexandre Arnt
4b5887b232 - Updated src strings. 2020-01-02 22:46:50 -03:00
Alexandre Arnt
6046669135 - BugFix: Don't let user exits Repoeditor without answering if he wants
to save changes.
2020-01-02 21:58:23 -03:00
Alexandre Arnt
aa4d30261b - Updated translations. 2020-01-02 16:57:38 -03:00
Alexandre Arnt
b8bf9495d0 - Reverted a change in window behaviour. 2020-01-02 14:56:17 -03:00
Alexandre Arnt
4f7822b4fb - Updated notifier windows behaviour. 2020-01-02 14:53:59 -03:00
Alexandre Arnt
2910f6ad34 Updated translations. 2020-01-02 10:04:10 -03:00
Alexandre Arnt
f41beff873 - Updated translations. 2019-12-31 09:41:46 -03:00
Alexandre Arnt
31fb2dac94 - String fixes. 2019-12-30 23:23:11 -03:00
Alexandre Arnt
7424ba3d60 - Bugfix in Options Dialog exec code. 2019-12-30 22:34:33 -03:00
Alexandre Arnt
26e5cd3514 - Updated translations. 2019-12-30 18:19:30 -03:00
Alexandre Arnt
0a7f7c782e - Updated translations. 2019-12-29 22:44:00 -03:00
Alexandre Arnt
5d6a3af63b - Updated mainwindow.ui. 2019-12-29 22:13:18 -03:00
Alexandre Arnt
90b237b9c8 - Updated translations;
- Fixed voting code.
2019-12-29 22:00:05 -03:00
Alexandre Arnt
dd71f2df80 - Bugfix in optionsdialog.ui. 2019-12-29 21:34:37 -03:00
Alexandre Arnt
c9be44ab2f - Options Dialog fixes. 2019-12-29 21:17:08 -03:00
Alexandre Arnt
6642916612 - Updated menu. 2019-12-29 20:06:30 -03:00
Alexandre Arnt
4dae7f8af4 - Source str fix. 2019-12-29 19:43:22 -03:00
Alexandre Arnt
894928eed3 - Updated git ignore file. 2019-12-29 15:09:00 -03:00
Alexandre Arnt
3f8a5a6bd5 - Updated translations. 2019-12-29 14:54:23 -03:00
Alexandre Arnt
784fc6f20e - Updated source strings. 2019-12-29 14:43:47 -03:00
Alexandre Arnt
f5d49c6ef6 - Let's print 0 Bytes as well on upgrade transaction dialog. 2019-12-29 11:54:41 -03:00
Alexandre Arnt
9c8617d452 - Color removal in pacman parser and notifier bugfix in output window
focus.
2019-12-29 11:27:59 -03:00
Alexandre Arnt
0867327d2a - BugFix in foreign pkg description tooltip code. 2019-12-27 22:28:23 -03:00
Alexandre Arnt
4df7758e82 - Updated checkupdates exit code in notifier. 2019-12-27 10:31:54 -03:00
Alexandre Arnt
25965581ab - BugFix with new checkupdates return code. 2019-12-26 14:56:27 -03:00
Alexandre Arnt
33b72056a9 - Updated README.md. 2019-12-26 14:38:22 -03:00
Alexandre Arnt
ffc984824d - Updated README.md. 2019-12-23 16:42:28 -03:00
Alexandre Arnt
5cccfce28e - Linux distros die... 2019-12-23 16:33:33 -03:00
Alexandre Arnt
fe27630042 - Refactorings. 2019-12-23 14:53:57 -03:00
Alexandre Arnt
29180a1040 - Couple of small refactorings. 2019-12-23 14:25:53 -03:00
Alexandre Arnt
24789355be - Updated gitignore file. 2019-12-23 13:43:32 -03:00
Alexandre Arnt
edb0f4b369 - Updated translations. 2019-12-23 13:19:05 -03:00
Alexandre Arnt
91b6dd48fe - BugFix: Sometimes terminal actions did not end correctly. 2019-12-23 11:58:56 -03:00
Alexandre Arnt
f667d025c5 - Updated AUR msg size in optionsdialog.ui. 2019-12-23 11:11:08 -03:00
Alexandre Arnt
7131a6bc84 - Defaults to using ALPM backend 2019-12-20 21:36:51 -03:00
Alexandre Arnt
9d60096df9 - Remove + from string. 2019-12-15 18:16:40 -03:00
Alexandre Arnt
494403333b - Removed redundant code (default is monospace font). 2019-12-15 18:07:57 -03:00
Alexandre Arnt
8c25a5299d - Bugfix in help. 2019-12-15 17:35:12 -03:00
Alexandre Arnt
c51789c892 - Help fix. 2019-12-15 17:30:47 -03:00
Alexandre Arnt
6bdef66282 - Bugfixes in foreign desc and actions exec. 2019-12-15 16:42:07 -03:00
Alexandre Arnt
7796ad2a55 Bugfix in running actions on terminal not refreshing outdated pkg list. 2019-12-14 20:13:14 -03:00
Alexandre Arnt
5241d0f58c - Comment bash history flood code in terminal (thx to demm). 2019-12-04 14:40:23 -03:00
Alexandre Arnt
f09c7753ab - Changed default behaviour in notifier with KSTATUS flag. 2019-12-03 18:24:50 -03:00
Alexandre Arnt
92a42d5c9b - Remove old helper if it still exists 2019-12-03 17:56:52 -03:00
Alexandre Arnt
06b3f8c6b1 - Updated some comments 2019-12-02 23:05:53 -03:00
Alexandre Arnt
700809bc77 - Updated README.md file. 2019-12-02 22:55:45 -03:00
Alexandre Arnt
ca8196007c - Changed helper binary name to "octphelper". 2019-12-02 21:57:04 -03:00
Alexandre Arnt
698ce813c1 - Added version in helper. 2019-12-02 20:57:03 -03:00
Alexandre Arnt
6ad8d296ad - Refactorings in helper. 2019-12-02 18:59:00 -03:00
Alexandre Arnt
b8a781e3c4 - Use full bin path. 2019-12-02 17:48:35 -03:00
Alexandre Arnt
0f4d0d2cde - Use full bin path in helper. 2019-12-02 09:55:10 -03:00
Alexandre Arnt
195aca81bb - Temp Refactoring. 2019-11-24 06:07:25 -03:00
Alexandre Arnt
162b31ef2a - Updated readme file. 2019-11-22 16:56:45 -03:00
Alexandre Arnt
d076398cce - Added AUR use warning at optionsdialog.ui. 2019-11-22 16:14:58 -03:00
Alexandre Arnt
abeee87c69 - Refactoring in help code. 2019-11-22 15:46:53 -03:00
Alexandre Arnt
836cb01391 - Refactorings in cleaner and helper code. 2019-11-22 15:14:03 -03:00
Alexandre Arnt
529a867a95 - Removed unused code. 2019-11-22 10:45:14 -03:00
Alexandre Arnt
4b719f5106 - Refactorings in helper code. 2019-11-22 10:30:21 -03:00
Alexandre Arnt
b9cfee3163 Updated readme file 2019-11-22 09:26:12 -03:00
Alexandre Arnt
5e9cd21f2b - Change dir to home at termwidget.cpp. 2019-11-21 22:04:48 -03:00
Alexandre Arnt
9eb1faa8ca - Bugfix in parser when installing linux packages. 2019-11-21 21:32:12 -03:00
Alexandre Arnt
a3e53728e3 - Added octopi-mainwindow.png file. 2019-11-21 12:19:18 -03:00
Alexandre Arnt
c1dd1dd669 Merge branch 'master' of https://github.com/aarnt/octopi 2019-11-21 11:59:33 -03:00
Alexandre Arnt
2623504bc8 - Refactorings in actions code. 2019-11-21 11:59:09 -03:00
Alexandre Arnt
6caaef4b9a Merge pull request #403 from MatMoul/master
Update Exec in .desktop files
2019-11-19 17:37:50 -03:00
MatMoul
7b3ccfb67d Update Exec in .desktop files 2019-11-19 20:52:36 +01:00
Alexandre Arnt
377bbc702a - Make CacheCleaner/Helper more secure. 2019-11-18 22:54:43 -03:00
Alexandre Arnt
f388a9cc8c - Refactorings in local pkg install. 2019-11-18 18:08:47 -03:00
Alexandre Arnt
a3707b857d - Bugfixes in install code. 2019-11-17 00:03:30 -03:00
Alexandre Arnt
23323442f2 - Better comment. 2019-11-16 22:48:39 -03:00
Alexandre Arnt
8f13211b8b - Refactorings for calm warnings down. 2019-11-16 22:32:46 -03:00
Alexandre Arnt
c9a8e2156f - More refactorings in notifier/helper/octopi. 2019-11-16 21:25:50 -03:00
Alexandre Arnt
614850f056 - Refactorings to make Octopi more secure. 2019-11-16 19:25:00 -03:00
Alexandre Arnt
4fe304e5bf - Bugfix in double context menu connections in AUR mode;
- Removed unused code.
2019-11-16 16:31:59 -03:00
Alexandre Arnt
20e6874771 - Refactorings in helper. 2019-11-16 15:10:45 -03:00
Alexandre Arnt
2610359c29 - refactorings in helper. 2019-11-16 15:06:48 -03:00
Alexandre Arnt
24099a0892 - removed unneeded code 2019-11-16 15:01:36 -03:00
Alexandre Arnt
04127c4ab9 - Got rid of all unsafe execution methods. 2019-11-16 14:55:01 -03:00
Alexandre Arnt
296a7848b4 - Only -ts in octopi-sudo! 2019-11-16 13:44:59 -03:00
Alexandre Arnt
041688a996 - Let helper only get from mem. 2019-11-16 12:20:46 -03:00
Alexandre Arnt
46f5efb418 - Added "copy" command to octopi's embedded terminal context menu. 2019-11-16 12:18:59 -03:00
Alexandre Arnt
abc5e76913 - Make .bak file more robust. 2019-11-16 11:24:43 -03:00
Alexandre Arnt
15899fccbd - Using the proper shell in helper. 2019-11-16 10:41:11 -03:00
Alexandre Arnt
b048c1c002 - RepoEditor now saves window size/position. 2019-11-16 10:20:39 -03:00
Alexandre Arnt
a38b24afc4 - Refactorings in octopi/notifier code. 2019-11-16 08:55:48 -03:00
Alexandre Arnt
8c50c14fe0 - Refactoring to cachecleaner code. 2019-11-15 19:08:05 -03:00
Alexandre Arnt
01b5e3c01b - Refactorings in sudo. 2019-11-15 18:29:27 -03:00
Alexandre Arnt
1b92868b15 - Migration to memory trans. 2019-11-15 18:19:26 -03:00
Alexandre Arnt
0e8805e5eb - Refactoring in helper. 2019-11-15 11:46:29 -03:00
Alexandre Arnt
661d28956b - BugFix in terminal exec code. 2019-11-15 11:39:20 -03:00
Alexandre Arnt
cdead9468c - Refactorings in helper. 2019-11-15 10:47:03 -03:00
Alexandre Arnt
9aad3f97b6 - Helper refactorings. 2019-11-14 17:56:33 -03:00
Alexandre Arnt
002fd0180e - Sharedmem refactorings. 2019-11-13 23:42:05 -03:00
Alexandre Arnt
245db0572a - Refactorings in helper. 2019-11-13 15:36:58 -03:00
Alexandre Arnt
f913972868 - Couple of Refactorings. 2019-11-13 13:38:14 -03:00
Alexandre Arnt
db2eecd8bc - Various bugfixes and enhancements. 2019-11-12 23:37:10 -03:00
Alexandre Arnt
3f912fe637 - Reverted change. 2019-11-12 19:48:19 -03:00
Alexandre Arnt
0e7a6c15a7 - Bugfix in local install. 2019-11-12 17:58:52 -03:00
Alexandre Arnt
5eb575e496 - Bugfixes in helper and refactorings. 2019-11-12 17:34:21 -03:00
Alexandre Arnt
b93df38efa - Some KaOS bugfixes. 2019-11-10 19:34:40 -03:00
Alexandre Arnt
bbe56f6f2d - Bugfixes in AUR mode switch. 2019-11-08 21:56:42 -03:00
Alexandre Arnt
149517e436 - BugFix: pacman pkg list shows no value when text is cleared after an
AUR search.
2019-11-07 14:35:20 -03:00
Alexandre Arnt
907432c0b3 - Test conectivity (if enabled) in temp yay download. 2019-11-07 13:49:33 -03:00
Alexandre Arnt
b5c7526cea - Comment unused code. 2019-11-07 11:46:34 -03:00
Alexandre Arnt
de8019d8fc - Removed "expac" dependency. 2019-11-06 23:11:24 -03:00
Alexandre Arnt
aacec874d7 - Reverted tx commit. 2019-11-06 13:15:11 -03:00
Alexandre Arnt
b5dd3922a3 - Updated tx. 2019-11-06 11:32:17 -03:00
Alexandre Arnt
ed4a1d8f21 - Removed unneeded tx. 2019-11-06 11:24:29 -03:00
Alexandre Arnt
2a2eb93187 - Remove temp yay download files. 2019-11-05 14:07:46 -03:00
Alexandre Arnt
4eaed8dba6 - Cosmetic fix in AUR/pacman list switch. 2019-11-04 23:30:01 -03:00
Alexandre Arnt
4b0703ece5 - AUR code updated. 2019-11-04 23:12:17 -03:00
Alexandre Arnt
b3c5378920 - Remove unused code. 2019-11-04 17:47:36 -03:00
Alexandre Arnt
2b4b20b9fa - Updated aur/switch button code. 2019-11-04 17:36:31 -03:00
Alexandre Arnt
3e4db580eb - Fix in focus when "crtl+shift+O" used. 2019-11-04 13:56:06 -03:00
Alexandre Arnt
091f0a12b6 - BugFix: outdatedversion with ")" char. 2019-11-04 11:43:26 -03:00
Alexandre Arnt
8ccc3016c7 - Updated tab info code. 2019-11-04 09:07:08 -03:00
Alexandre Arnt
0f17fb16c4 - Help usage changes;
- Added "ctrl+shift_O" to get AUR outdated packages;
- Context menu fixes for AUR pkgs.
2019-11-03 23:36:51 -03:00
Alexandre Arnt
8890a7cb87 - Updated help usage text. 2019-11-03 22:19:55 -03:00
Alexandre Arnt
4a273bd826 Fixed sudo's README.md file. 2019-11-03 12:57:08 -03:00
Alexandre Arnt
f4c3222174 - Updated README.md file. 2019-11-03 12:44:35 -03:00
Alexandre Arnt
1d44a52981 - Added "ctrl+shift+A" option on Help/Usage text. 2019-11-03 12:36:24 -03:00
Alexandre Arnt
ccabf3d4e9 - Whenever user selects "options" at notifier and octopi is running, we
open options from Octopi.
2019-11-03 11:24:31 -03:00
Alexandre Arnt
ed0a6c8b82 Changed behaviour in notifier to show updates when systray icon is clicked. 2019-10-31 22:34:48 -03:00
Alexandre Arnt
044bf6c594 Merge branch 'master' of https://github.com/aarnt/octopi 2019-10-31 21:27:23 -03:00
Alexandre Arnt
af37001a64 - Test if "expac" is installed. 2019-10-31 21:26:49 -03:00
Alexandre Arnt
84810b9a97 Update README.md
Fixed a typo
2019-10-31 13:49:24 -03:00
Alexandre Arnt
f7e5e6ed7b - Added 'expac' dependency to speed up refresh code. 2019-10-28 00:19:09 -03:00
Alexandre Arnt
95ff43b71d - Added shortcut to list all AUR voted packages. 2019-10-27 11:08:31 -03:00
Alexandre Arnt
1ecdba57bd - Some bugfixes. 2019-10-23 23:31:06 -03:00
Alexandre Arnt
7c5e3f9f27 - BugFix: checkupdates now returns 1 when no update is available. 2019-10-15 22:00:20 -03:00
Alexandre Arnt
87b0a8e7af - Add support to arcolinux 2019-10-06 21:05:45 -03:00
Alexandre Arnt
930b4c023f - Added method to retrieve all user voted package names. 2019-10-01 23:24:36 -03:00
Alexandre Arnt
13848f9525 - Fix in aurvote.cpp. 2019-10-01 19:41:59 -03:00
Alexandre Arnt
0f43222795 - Fix in optionsdialog.ui. 2019-09-23 18:04:21 -03:00
Alexandre Arnt
a88a20775d - Uniformization of fontsize in optionsdialog.ui. 2019-09-23 17:57:52 -03:00
Alexandre Arnt
d04cf46c61 - BugFix: missing class in project file. 2019-09-23 17:24:33 -03:00
Alexandre Arnt
0bec405a61 - BugFix: missing ../src/qaesencryption.* file at .pro. 2019-09-23 15:51:58 -03:00
Alexandre Arnt
99a2fb5c8f - Text fix. 2019-09-21 11:35:23 -03:00
Alexandre Arnt
274da64555 - BugFixes in SettingsManager code. 2019-09-21 11:27:57 -03:00
Alexandre Arnt
ed43e44883 - Refactorings. 2019-09-21 00:21:11 -03:00
Alexandre Arnt
01ea313e93 - BugFixes in pkg list and panel save settings. 2019-09-21 00:05:32 -03:00
Alexandre Arnt
ee03eb4a67 - Added option to download a temporary yay-bin to enable AUR. 2019-09-20 22:13:51 -03:00
Alexandre Arnt
bf615b96a7 - Refactorings. 2019-09-20 11:20:58 -03:00
Alexandre Arnt
ce1374844a - Refactorings. 2019-09-20 10:08:52 -03:00
Alexandre Arnt
6f191e2dba - Removed SwagArch support. RIP SwagArch :-( 2019-09-20 09:59:48 -03:00
Alexandre Arnt
07cd087d9e - Fix AUR tab showing at OptionsDialog. 2019-09-20 09:32:48 -03:00
Alexandre Arnt
bc659f50dc - Some refactorings;
- Asks user if he wants to vote for Octopi (at connection test).
2019-09-20 09:18:12 -03:00
Alexandre Arnt
98c4b4dc70 - Added support for EndeavourOS (former Antergos). 2019-09-20 00:04:41 -03:00
Alexandre Arnt
7a0ff75fba - Some refactorings. 2019-09-19 21:57:00 -03:00
Alexandre Arnt
c2b1c84268 - Added option to vote/unvote in AUR packages using aur.archlinux.org
login.
2019-09-19 21:43:23 -03:00
Alexandre Arnt
12b34017e7 - BugFix: Sometimes non-outdated AUR packages did not get refreshed;
- Position at the tab that generated an error in Options dialog.
2019-09-15 18:42:48 -03:00
Alexandre Arnt
d76eb8b1c8 - Some icon changes in notifier. 2019-09-15 12:13:10 -03:00
Alexandre Arnt
9a679424d7 - BugFix: Let YAY tool upgrade its outdated packages. 2019-09-10 22:20:51 -03:00
Alexandre Arnt
6855629524 Merge pull request #390 from nicolasfella/desktopentry
Set desktop file name
2019-09-03 10:25:00 -03:00
Nicolas Fella
87206bbcc8 Set desktop file name 2019-09-03 00:27:38 +02:00
Alexandre Arnt
395291481a Merge branch 'master' of https://github.com/aarnt/octopi 2019-09-01 22:58:58 -03:00
Alexandre Arnt
2a5fe191b0 - Added class to support AUR vote;
- BugFix: Now Actions tab is disable while in AUR mode;
- Refactorings here and there.
2019-09-01 22:54:24 -03:00
Alexandre Arnt
c5d39dae42 - Added class to support AUR vote;
- BugFix: Now Actions tab is disable while in AUR mode;
- Refactorings here and there.
2019-09-01 22:25:26 -03:00
Alexandre Arnt
2f601d3650 Merge branch 'master' of https://github.com/aarnt/octopi
Merge PKGBUILD...
2019-08-18 19:35:23 -03:00
Alexandre Arnt
f3128bf86d - Renamed Transaction tab to Actions tab;
- Fixed deprecated code.
2019-08-18 19:32:16 -03:00
Alexandre Arnt
b4d38db487 Merge pull request #387 from Maryse47/patch-1
PKGBUILD: build from git instead of tarball
2019-08-15 13:41:42 -03:00
Maryse47
f9aa8573a5 PKGBUILD: build from git instead of tarball 2019-08-14 19:03:47 +00:00
Alexandre Arnt
31060ae2b2 - Added tooltip "Upgrading..." while Notifier is upgrading the system.
- BugFix: "exists in filesystem" messages during transactions are shown
again.
2019-07-21 19:52:57 -03:00
Alexandre Arnt
72a922a080 - Helper no longer execs if pacman is already running outside;
- Added option to enable/disable internet checking;
- Maximization of properties pane now hides tab bar.
2019-07-13 20:12:28 -03:00
Alexandre Arnt
d23565750a - unused parm. 2019-06-30 19:58:00 -03:00
Alexandre Arnt
841a0310cf Fix paste error 2019-06-25 22:55:30 -03:00
Alexandre Arnt
198cc22caf - Added option to disable confirmation dialog in system upgrade;
- Added security check to cancel system upgrades in GUI when pacman is
in the list;
- Couple of fixes in some files.
2019-06-25 22:46:38 -03:00
Alexandre Arnt
bf229e28ce - Removed unused code;
- Added accelerators to menuitens.
2019-06-24 22:08:57 -03:00
Alexandre Arnt
c780fddb47 - Removed unused code. 2019-06-23 21:38:30 -03:00
Alexandre Arnt
43ed522fa8 - Fixes some files. 2019-06-20 23:04:09 -03:00
Alexandre Arnt
d79b079677 - Fixed typo. 2019-06-20 22:19:38 -03:00
Alexandre Arnt
b0448a4bd7 - Updated files. 2019-06-20 22:18:17 -03:00
Alexandre Arnt
e0792d776f - Fixed PKGBUILD to always use latest git version;
- Fixed notifier to always use mandatory qtermwidget.
2019-06-20 21:59:18 -03:00
Alexandre Arnt
45941fa780 - Updated helper path;
- Added check for 'octopi-helper' in Octopi.
2019-06-20 21:05:10 -03:00
Alexandre Arnt
fdcb59ae4a - BugFix: ESC was not closing upgrade dialog in notifier if command had
finished.
2019-06-19 22:58:59 -03:00
Alexandre Arnt
ed2100c40f - Some missing LXQt files. 2019-06-19 22:42:49 -03:00
Alexandre Arnt
6d55356219 - Various important changes to make Octopi run smoothly with only one
terminal and one sudo tool.
2019-06-19 22:40:44 -03:00
Alexandre Arnt
7b6b8d79b1 - Added .gitignore file. 2019-06-18 23:10:31 -03:00
Alexandre Arnt
29860a0d80 - Bugfix 2019-06-18 23:04:09 -03:00
Alexandre Arnt
954419baa3 - Added a built-in default priviledge scalation tool: "octopi-sudo" as a
slightly modified version of "lxqt-sudo" project.
2019-06-18 22:59:42 -03:00
Alexandre Arnt
8b05da2c3b - BugFix: Do not show warning when trying to ESC after a system upgrade
is done in notifier.
2019-06-18 15:07:21 -03:00
Alexandre Arnt
ef3e5c6197 - Notifier folder reorganization. 2019-06-18 14:38:36 -03:00
Alexandre Arnt
306b846b9d - Small fixes. 2019-06-18 11:06:34 -03:00
Alexandre Arnt
5d54c1f28f - Removed no longer used pacmanhelper code. 2019-06-18 10:38:46 -03:00
Alexandre Arnt
4b883b4870 Got rid of default exit icon 2019-06-17 20:51:30 -03:00
Alexandre Arnt
2f5c563236 - Removed support to terminal selection. Octopi now only works with
QTERMWIDGET.
2019-06-17 19:11:08 -03:00
Alexandre Arnt
f94ee1a04b - User can now press ESC and abort sysupgrade in notifier;
- Checkupdates code fixes;
2019-05-12 10:23:48 -03:00
Alexandre Arnt
1060b3c800 - Fixed checkupdates code. 2019-05-11 21:11:28 -03:00
Alexandre Arnt
1717ec4ceb - BugFix: Notifier should use same PacmanExec code for checkUpdates. 2019-05-11 20:36:59 -03:00
Alexandre Arnt
ddb1131ea8 - Removed unused method. 2019-05-11 20:07:11 -03:00
Alexandre Arnt
8fa0f1d4b8 - BugFix: checkupdates would return more than 1 time from QProcess and
generate a QList index out of bounds exception.
2019-05-11 20:03:59 -03:00
Alexandre Arnt
7b81db5ce1 Merge pull request #374 from Maryse47/Maryse47-patch-1
octopihelper: fix install path
2019-04-23 17:28:22 -03:00
Alexandre Arnt
3d9dbfb5fa Merge pull request #375 from Maryse47/Maryse47-patch-2
PKGBUILD fixes
2019-04-23 17:26:56 -03:00
Alexandre Arnt
18ce8177f7 - Bugfix in notifier code. 2019-04-22 22:23:54 -03:00
Alexandre Arnt
2145455c12 - Bugfixes in aur search code. 2019-04-22 22:15:15 -03:00
Alexandre Arnt
882f876e2b - BugFix in mainwindow_transaction.cpp code. 2019-04-22 21:15:02 -03:00
Maryse47
ab87f72781 PKGBUILD fixes
Double quote variables
Call default buildflags in octopi.pro
Add PFREFIX
2019-04-22 17:29:09 +00:00
Maryse47
b3c67e5d8f octopihelper: fix install path
Without those rules octopi-helper is installed to /octopi root dir.
2019-04-22 16:55:38 +00:00
Alexandre Arnt
abc15557d9 - BugFixes in aur code 2019-04-21 23:15:24 -03:00
Alexandre Arnt
8b1e670281 - BugFix in row colors switch string. 2019-04-21 19:40:41 -03:00
Alexandre Arnt
499cbbe9b9 - Added option for changing use of alternating row colors in package
list.
2019-04-21 19:27:56 -03:00
Alexandre Arnt
31555d6bc4 - BugFix: Let's clear check update lists before we check it again :-) 2019-04-21 17:33:51 -03:00
Alexandre Arnt
7a32ba9ea2 - Adapting notifier to use "checkupdates" instead "pacman -Syy". 2019-04-21 17:18:51 -03:00
Alexandre Arnt
a1775be6b0 BugFix: make "open terminal here" option work with qtermwidget. 2019-04-21 14:25:43 -03:00
Alexandre Arnt
22b89268c0 - Refactorings based on cppcheck execution. 2019-04-21 12:32:22 -03:00
Alexandre Arnt
c1d60de3cc - Updated README.md file. 2019-04-21 12:01:53 -03:00
Alexandre Arnt
b550b4d7bf - Warn users of changes. 2019-04-21 11:53:51 -03:00
Alexandre Arnt
2e577dbbb2 - Removed unused code. 2019-04-21 11:51:16 -03:00
Alexandre Arnt
b21ad34f77 - Refactorings proposed by cppcheck tool. 2019-04-21 11:05:40 -03:00
Alexandre Arnt
4e9028462e - Code refactorings in SettingsManager. 2019-04-21 09:56:35 -03:00
Alexandre Arnt
24e73b68c9 - Added "yay" AUR tool support;
- Reworked AUR tab in Options dialog.
2019-04-19 22:27:39 -03:00
Alexandre Arnt
c1c8d8e91a - A couple of refactorings. 2019-04-19 17:41:42 -03:00
Alexandre Arnt
a6e171abee BugFix in outputOutdatedPackageList code. 2019-04-19 17:33:38 -03:00
Alexandre Arnt
67ded2c136 - Removed unused code in notifier;
- Added checkupdates file check in octopi.
2019-04-18 16:56:02 -03:00
Alexandre Arnt
85acca454f - pacmanhelper is not needed anymore. 2019-04-18 16:48:42 -03:00
Alexandre Arnt
679477296f - Commented all syncDatabase code. 2019-04-18 16:42:55 -03:00
Alexandre Arnt
62a443dc31 - Updated Sync db action name. 2019-04-18 16:22:05 -03:00
Alexandre Arnt
67bfc99983 - Changes to mark outdated packages in the pkg list after a "check
updates" command.
2019-04-18 16:08:33 -03:00
Alexandre Arnt
4fb2ea22f4 - BugFix: Changed 'Sync database' to 'Check updates' command. 2019-04-18 15:34:37 -03:00
Alexandre Arnt
94d1cd3c27 Update CHANGELOG
Updated CHANGELOG file.
2019-04-16 13:43:43 -03:00
Alexandre Arnt
178bbc1751 - BugFix: Notifier now uses "checkupdates" instead "pacman -Sy[y]" 2019-04-15 22:40:38 -03:00
Alexandre Arnt
743f85015a - BugFix: Always do a "pacman -Syu" in System Upgrade and remove Sync
database option.
- BugFix: Pkg build date obeys Locale datetime format.
- Removed "Sync database" option to mitigate "partial updates" issues.
2019-04-15 22:04:11 -03:00
Alexandre Arnt
ff8c2c8435 Code fixes. 2019-04-13 19:41:52 -03:00
Alexandre Arnt
82f525c21e - Some code fixes for terminal.cpp. 2019-04-13 13:13:23 -03:00
Alexandre Arnt
941e467b93 - Removed some unused code and changed sysinfo msg. 2019-04-13 12:25:18 -03:00
Alexandre Arnt
5e6be67cc9 - BugFix: Speed improvements in package list building. 2019-04-11 21:22:50 -03:00
Alexandre Arnt
34c446fc29 - Added support for GNOME file manager/editor.
-  BugFix: Added support for symbolic lynks in "open file".
2019-04-10 22:31:03 -03:00
Alexandre Arnt
0ee7ca1a74 - Trying to maximize startup speed with foreign pkg code
- Initial support to SwagArch distro
2019-04-09 22:53:35 -03:00
Alexandre Arnt
408cbd6446 - Updated generated SysInfo msg. 2019-03-30 17:35:30 -03:00
Alexandre Arnt
535f2c1839 - Let's speed up TransactionDialog if there are outdated packages. 2019-03-30 12:13:22 -03:00
Alexandre Arnt
ec43d1ef12 - Refinements in SysInfo code. 2019-03-30 11:37:36 -03:00
Alexandre Arnt
0848e2f75e - Added option to never synchronize package db in Notifier. 2019-03-30 11:19:53 -03:00
Alexandre Arnt
cd68e45ac4 - Updated README.md file. 2019-03-30 10:34:11 -03:00
Alexandre Arnt
957d4e8a03 - BugFix: SysInfo no longer pushes the collected logs to a remote paste
service. It saves them locally.
2019-03-29 23:02:22 -03:00
Alexandre Arnt
27d053f5fb - BugFix: pikaur was not showing outdated pkgs. 2019-03-28 21:59:00 -03:00
Alexandre Arnt
16f5d0deeb Merge pull request #321 from ewilly/master
Added Pikaur (AUR tool) support
2019-03-28 20:22:50 -03:00
Alexandre Arnt
81c2232609 - Updated translations. 2019-03-27 21:53:11 -03:00
Alexandre Arnt
2f64c66b63 - BugFix: MultiselectionDialog did not resize pkg description
automatically.
2019-03-26 20:44:30 -03:00
Alexandre Arnt
76ee38a2d3 Merge pull request #369 from Maryse47/patch-1
Fix typo in PKGBUILD
2019-03-22 11:47:38 -03:00
Maryse47
fe495319e2 Fix typo in PKGBUILD
The correct filename is https://github.com/aarnt/octopi/blob/master/octopihelper/octopi-helper.pro
2019-03-22 12:45:11 +00:00
ewilly
f33ec2cc48 Fix issue when remove with --noedit param 2019-03-18 19:10:41 +01:00
ewilly
3e5257cae9 Merge branch 'master' of git://github.com/aarnt/octopi into aarnt-master 2019-03-17 10:48:27 +01:00
Alexandre Arnt
c7eb428c9e - Reverted buggy sysupgrade change. 2019-03-12 21:44:28 -03:00
Alexandre Arnt
63610228f2 BugFix: Some packages were not displaying Optional Deps at Info tab. 2019-03-11 22:06:57 -03:00
Alexandre Arnt
1cc1036468 Added option to exit Octopi while a transaction is already running. 2019-03-10 21:50:48 -03:00
Alexandre Arnt
adfd514772 - Added another supported command to octopihelper. 2019-03-10 19:33:26 -03:00
Alexandre Arnt
79731ccb69 BugFix: OptionsDialog was not saving AUR settings if tab changed before
clicking OK.
2019-03-10 12:04:01 -03:00
Alexandre Arnt
9cb3f72a9b - Bugfix in notifier code. 2019-03-10 11:50:41 -03:00
Alexandre Arnt
1dba4e4565 - Obligatory readme file... 2019-03-07 22:13:24 -03:00
Alexandre Arnt
9600933b63 - Huge batch of changes mostly related to adding support for sudo (and
NOPASSWD) thru the use of "octopi-helper" subproject.

NOPASSWD mode will *ONLY* work when using "lxqt-sudo" root escalation
tool.
2019-03-07 22:10:09 -03:00
ewilly
ec5a01925f Merge branch 'aarnt-master' 2019-01-04 17:44:23 +01:00
ewilly
d0a55bba67 Merge branch 'master' of git://github.com/aarnt/octopi into aarnt-master 2019-01-04 17:43:52 +01:00
Alexandre Arnt
df6f0467a5 - BugFix: Changed command to Reinstall/Update when package is already installed or outdated. 2019-01-04 17:25:27 +01:00
Alexandre Arnt
3d6f0723f5 - Bumped version number. 2019-01-04 17:25:27 +01:00
Alexandre Arnt
3ee20b8b76 - Changed ptpb SysInfo logic to show more parameters and keep it remotely for 15 minutes. - Left click on package icon in package list brings context menu. - BugFix: Notifier checked for available internet connection too early with an error dialog box. 2019-01-04 17:25:27 +01:00
Alexandre Arnt
359584ba93 - BugFix: If user chooses QTermWidget as his terminal, "Open root
terminal" doesn't work.
2019-01-03 21:52:43 -02:00
Alexandre Arnt
fa8083599a - BugFix: Info and Files tabs were not showing any info automaticaly
when switching between foreign tool/pacman lists.
- BugFix: Reset visited packages list when switching between foreign and
pacman tools.
2019-01-03 12:11:09 -02:00
Alexandre Arnt
25971985ee - Tried to lighten the burden of opening transaction dialog when there
are many updates available in a sysupgrade.
2019-01-03 11:12:31 -02:00
Alexandre Arnt
b0613be2a2 - Added "Info" option in package list context menu.
- BugFix: Clear filter line edit when navigating thru package anchors at
Info tab.
2019-01-02 20:36:51 -02:00
Alexandre Arnt
241169308a - BugFix: Changed command to Reinstall/Update when package is already
installed or outdated.
2019-01-02 18:04:47 -02:00
Alexandre Arnt
58757a23a2 - Bumped version number. 2019-01-02 17:37:08 -02:00
Alexandre Arnt
e062b9c5f8 - Changed ptpb SysInfo logic to show more parameters and keep it
remotely for 15 minutes.
- Left click on package icon in package list brings context menu.
- BugFix: Notifier checked for available internet connection too early
with an error dialog box.
2019-01-02 17:02:21 -02:00
ewilly
ead4189904 Merge pull request #7 from aarnt/master
Update
2018-12-03 19:12:06 +01:00
Alexandre Arnt
cdbaccaadd Merge pull request #356 from sudobaal/lxsudo
lxqt-sudo behavior changed, see https://github.com/lxqt/lxqt/issues/1534
2018-12-03 09:14:18 -02:00
Ludovic Richard
80414e2177 lxqt-sudo behavior changed, see https://github.com/lxqt/lxqt/issues/1534 2018-10-28 12:02:24 +13:00
Alexandre Arnt
b7fa1be650 Merge pull request #348 from xfix/patch-1
Replace us_EN language with en_US
2018-09-05 10:50:38 -03:00
Konrad Borowski
f46d16ca03 Replace us_EN language with en_US
There is no such language as us_EN
2018-08-25 10:06:15 +02:00
ewilly
7d7910f934 Update 2018-06-10 18:59:38 +02:00
ewilly
6a5637023f Merge branch 'master' into master 2018-06-10 15:02:53 +02:00
Alexandre Arnt
251822c887 - Updated PKGBUILD. 2018-06-08 16:06:21 -03:00
Alexandre Arnt
553068128b - Enhanced embeded terminal behaviour.
- Bumped version number to 0.9.0.
2018-06-08 15:53:58 -03:00
Alexandre Arnt
aea5e2cf09 - Removed "loading" from the pattern of green messages. 2018-06-07 16:57:01 -03:00
Alexandre Arnt
91dfad1faf - Enhancements in help/about dialog. 2018-06-07 15:23:49 -03:00
Alexandre Arnt
6f2401e10a - Removed unused code. 2018-06-07 11:52:49 -03:00
Alexandre Arnt
72c0a0ba11 - Dropped PacBSD from the list of compatible distros. 2018-06-07 11:42:33 -03:00
Alexandre Arnt
fa7e88d370 - BugFix: We do not need wait cursors when we are using threads ;-) 2018-06-06 18:09:45 -03:00
Alexandre Arnt
3935abcd82 - BugFix: Another way to test network connectivity. 2018-06-06 17:03:14 -03:00
Alexandre Arnt
10c78af877 - BugFix in sysinfo code. 2018-06-06 15:34:06 -03:00
Alexandre Arnt
2d2b29f0d0 - BugFix: Make SysInfo runs in its own thread, so UI is not blocked. 2018-06-06 15:28:36 -03:00
Alexandre Arnt
45fa9697ad - BugFix in code that checks updated news. 2018-06-05 19:38:48 -03:00
Alexandre Arnt
f0bf295aab - BugFix: Local package install inside qtermwidget needed a SIGNAL
connect to work;
- Prevent the use of "--force" option if pacman version >= 5.1.
2018-06-05 18:47:03 -03:00
Alexandre Arnt
17123d9428 - Updated README.md file. 2018-06-05 18:00:26 -03:00
Alexandre Arnt
b9f0c6b73c - Do NOT clear search string when switching between AUR/pacman. 2018-06-05 17:37:19 -03:00
Alexandre Arnt
a64adfb404 - BugFix: Better not clear embeded console after aur transaction. 2018-06-05 17:13:00 -03:00
Alexandre Arnt
f192bc7aa6 - BugFix: Better way to deal with updated news. 2018-06-05 17:10:26 -03:00
Alexandre Arnt
1c07b57afa - BugFix: If threre are updated News after a synchronization, let's goto
the News Tab.
2018-06-05 11:03:22 -03:00
Alexandre Arnt
e054cb0218 - Updated translations. 2018-06-05 10:42:52 -03:00
Alexandre Arnt
5009ee232c - BugFix: Let's not show AUR tab in optionsdialog if we are running
Parabola Linux.
2018-06-04 19:13:04 -03:00
ewilly
78604ed1f6 Merge pull request #5 from aarnt/master
Merge
2018-06-04 23:07:05 +02:00
Alexandre Arnt
42918df4a3 - BugFix: Chinese users do not ping google.com. 2018-06-04 11:24:58 -03:00
Alexandre Arnt
cafc92e030 Update README.md
Updated some distro sites.
2018-06-03 14:50:03 -03:00
Alexandre Arnt
be5fa78234 - BugFix: Remove only Octopi tools related temporary files
(qtsingleapp*).
2018-06-03 14:09:43 -03:00
Alexandre Arnt
cb16ea67de - Added pacman-contrib dependency for new pacman 5.1.
- Added a check at cache cleaner's startup.
2018-06-03 12:23:42 -03:00
ewilly
ab5866427e Merge pull request #4 from aarnt/master
- BugFix in Qt 5.11 compile.
2018-05-30 06:27:50 +02:00
Alexandre Arnt
b9654265f9 - BugFix in Qt 5.11 compile. 2018-05-29 10:32:07 -03:00
ewilly
598eff9abd Merge pull request #3 from aarnt/master
update from aarnt
2018-05-09 09:00:45 +02:00
Alexandre Arnt
73b1028fe8 - BugFix: sysinfo tests for internet connection. 2018-05-09 08:58:04 +02:00
Alexandre Arnt
abe3060ea9 - BugFix: Better search without "error". 2018-05-09 08:58:04 +02:00
Alexandre Arnt
2b644de025 - BugFix: Exec internet tests before some commands in Octopi and
Notifier.
2018-05-09 08:58:04 +02:00
Alexandre Arnt
ba802c6a7d - Added missed translation files.
- BugFix: Do not let program display an avalanche of internet related
errors.
- Let mirror-check display its internet errors.
2018-05-09 08:58:04 +02:00
Alexandre Arnt
2555fa645b - Removed unused code/Fix typo. 2018-05-09 08:58:04 +02:00
Alexandre Arnt
96300a0491 - BugFix: Use current octopi icon for notifer/help/about dialog. 2018-05-09 08:58:04 +02:00
Alexandre Arnt
d454c7e8f4 - BugFix in progressbar with mirrorcheck. 2018-05-09 08:58:04 +02:00
Alexandre Arnt
e1954e0821 - Added Hindi translation (thanks to Panwar108). 2018-05-09 08:58:04 +02:00
Alexandre Arnt
36aff057a5 - BugFix: UI hint for this not so fast operation. 2018-05-09 08:58:04 +02:00
Alexandre Arnt
70a68fde41 - BugFix: Let internal terminal receive focus when maximized/restored. 2018-05-09 08:58:04 +02:00
Alexandre Arnt
6af126c47c - BugFix in terminal cancel code. 2018-05-09 08:58:04 +02:00
Alexandre Arnt
7d5db3e3c7 - BugFix: Add Alt+7 shortcut to access terminal tab. 2018-05-09 08:58:04 +02:00
Alexandre Arnt
3547036a00 - BugFix: Make F11 works inside terminal tab. 2018-05-09 08:58:04 +02:00
Alexandre Arnt
3988003c17 - BugFix: Show progressbar with wait cursor. 2018-05-09 08:58:04 +02:00
Alexandre Arnt
1e585a9876 - Updated translation. 2018-05-09 08:58:04 +02:00
Alex Nemeth
5a2e61ba13 Enable HiDPI icons 2018-05-09 08:58:04 +02:00
Alexandre Arnt
3460389d2f Update PKGBUILD
Removed "gist" from optional dependencies.
2018-05-09 08:58:04 +02:00
Alexandre Arnt
0a599bfb0e - Remove gist / Add ptpb support (thanks to demm). 2018-05-09 08:58:04 +02:00
sheinz
d084dc016a Fixed processing multiple IgnorePkg/IgnoregGroup statements 2018-05-09 08:58:04 +02:00
sheinz
66b9e7ee1f Concatenate multiple IgnorePkg/IgnoreGroup statements 2018-05-09 08:58:04 +02:00
Alexandre Arnt
c413caadd1 - BugFix: sysinfo tests for internet connection. 2018-05-06 19:55:25 -03:00
Alexandre Arnt
bff4de2189 - BugFix: Better search without "error". 2018-05-06 18:54:24 -03:00
Alexandre Arnt
a9d9eb30d3 - BugFix: Exec internet tests before some commands in Octopi and
Notifier.
2018-05-06 18:23:46 -03:00
ewilly
f9063cf252 Pikaur : Fix color & search in aur 2018-05-04 16:23:35 +02:00
Alexandre Arnt
61f6a199e9 - Added missed translation files.
- BugFix: Do not let program display an avalanche of internet related
errors.
- Let mirror-check display its internet errors.
2018-04-29 16:38:55 -03:00
Alexandre Arnt
e59fe5ac8c - Removed unused code/Fix typo. 2018-05-06 16:04:43 -03:00
Alexandre Arnt
ee79c35b62 Merge pull request #320 from sheinz/fix-multiple-ignorepkg
Handle multiple IgnorePkg/IgnoreGroup statements
2018-05-06 12:57:52 -03:00
Alexandre Arnt
a3b1eaf68b - BugFix: Use current octopi icon for notifer/help/about dialog. 2018-04-29 16:07:11 -03:00
Alexandre Arnt
9a419e5ab6 - BugFix in progressbar with mirrorcheck. 2018-04-29 15:39:53 -03:00
Alexandre Arnt
8f82f46852 - Added Hindi translation (thanks to Panwar108). 2018-04-29 15:19:31 -03:00
Alexandre Arnt
f45a5a903a - BugFix: UI hint for this not so fast operation. 2018-04-29 14:33:21 -03:00
Alexandre Arnt
6b727bf114 - BugFix: Let internal terminal receive focus when maximized/restored. 2018-04-29 14:21:32 -03:00
Alexandre Arnt
2fad59554b - BugFix in terminal cancel code. 2018-04-29 14:15:35 -03:00
Alexandre Arnt
e8c3ff875c - BugFix: Add Alt+7 shortcut to access terminal tab. 2018-04-29 13:58:29 -03:00
Alexandre Arnt
12b7338b51 - BugFix: Make F11 works inside terminal tab. 2018-04-29 12:35:32 -03:00
Alexandre Arnt
c615f97362 - BugFix: Show progressbar with wait cursor. 2018-04-29 11:42:42 -03:00
Alexandre Arnt
d36e793864 - Updated translation. 2018-04-28 19:56:13 -03:00
Alexandre Arnt
f6fd67a33e Merge pull request #326 from alex47/master
Enable HiDPI icons
2018-04-28 09:58:06 -03:00
Alex Nemeth
b9958cafc9 Enable HiDPI icons 2018-04-28 11:39:46 +02:00
Alexandre Arnt
3849c5ad31 Update PKGBUILD
Removed "gist" from optional dependencies.
2018-04-26 17:43:11 -03:00
Alexandre Arnt
60bd2cd082 - Remove gist / Add ptpb support (thanks to demm). 2018-04-23 17:52:38 -03:00
ewilly
f9692ddd48 Pikaur : use --color=never 2018-04-22 21:49:30 +02:00
ewilly
5e29bc7145 Merge pull request #1 from aarnt/master
Merge from original
2018-04-22 18:32:04 +02:00
Alexandre Arnt
845311daf2 - BugFix: When you removed the only installed pkg while in AUR mode,
statusbar counters were not shown.
2018-04-21 21:44:23 -03:00
Alexandre Arnt
d35247c92a - BugFix: Show progress widget earlier in AUR (un)selection. 2018-04-21 19:38:54 -03:00
Alexandre Arnt
e8613527b6 BugFix: Exec internet tests before some commands. 2018-04-21 19:08:41 -03:00
ewilly
c053cf21a6 Added Pikaur (AUR tool) support 2018-04-03 22:08:27 +02:00
sheinz
e46725e998 Fixed processing multiple IgnorePkg/IgnoregGroup statements 2018-04-01 01:42:30 +03:00
Alexandre Arnt
27de3460cb - BugFix in test. 2018-03-31 19:17:12 -03:00
Alexandre Arnt
c067a37787 - Name of AUR package in Info tab act as link to its site at https://
aur.archlinux.org.
2018-03-31 18:51:40 -03:00
Alexandre Arnt
6bc18dd768 - Updated README.md file. 2018-03-31 14:48:35 -03:00
Alexandre Arnt
c9dbaebec4 - BugFix: Do not ask twice for password if a pacman lck file exists. 2018-03-31 14:23:04 -03:00
Alexandre Arnt
640d5633b4 - Added a couple of constants. 2018-03-31 12:19:23 -03:00
sheinz
b3887c8138 Concatenate multiple IgnorePkg/IgnoreGroup statements 2018-03-31 02:25:49 +03:00
Alexandre Arnt
14c69b0b53 - Updated translations. 2018-03-30 14:07:55 -03:00
Alexandre Arnt
13218919aa - BugFix: Do not disable AUR icon while in AUR mode. 2018-03-30 13:59:04 -03:00
Alexandre Arnt
465e23f98d - Added Trizen (AUR tool) support. 2018-03-30 13:43:56 -03:00
Alexandre Arnt
b578189f0d - Removed unused code. 2018-03-29 19:28:46 -03:00
Alexandre Arnt
fb7a1f9d6b - BugFix: Disable alien icon while in transaction. 2018-03-17 21:03:51 -03:00
Alexandre Arnt
3e3c6ae0fc Merge pull request #317 from scachemaille/scachemaille-patch-#315
Run octopi-repoeditor as normal user
2018-02-18 17:53:30 -03:00
Alexandre Arnt
eca942ec96 Merge pull request #313 from tim241/master
Fixed README.md
2018-02-15 11:12:31 -02:00
Stéphane
ff6c3c74e6 Run octopi-repoeditor as normal user
fix #315
2018-02-14 23:54:29 +01:00
Tim Wanders
9c886b1800 Update README.md 2018-02-13 17:46:27 +01:00
Alexandre Arnt
52e111f5ab - BugFix: QProcess was not calling "pacman" command anymore (at least
inside this service code). Had to add complete path to the command (a Qt
5.10 change).
2018-01-06 23:15:25 -02:00
Alexandre Arnt
669e85b63d - Updated CHANGELOG file. 2018-01-06 20:12:13 -02:00
Alexandre Arnt
035cd35ada - Bugfix in parser code. 2018-01-06 20:09:14 -02:00
Alexandre Arnt
fbe16eea44 - uncomment a code. 2018-01-06 19:23:06 -02:00
Alexandre Arnt
dab1bc3752 - Make "DO_NOT_USE_AUR" as default AUR tool :) 2018-01-06 18:45:34 -02:00
Alexandre Arnt
b48f4896e7 - Updated translations. 2018-01-06 18:10:52 -02:00
Alexandre Arnt
82acc74c24 - Back at using "pacman -Syy" in pacmanhelper.cpp. 2017-12-27 14:25:54 -02:00
Alexandre Arnt
8b4721320e Merge pull request #303 from Vincent43/patch-1
Support custom compiler flags in PKGBUILD
2017-12-19 10:10:21 -02:00
Vincent43
d0ec92cd24 Support custom compiler flags in PKGBUILD
Qmake doesn't honor user defined flags by default.
2017-12-16 11:02:18 +00:00
Alexandre Arnt
1759559de0 - Updated CHANGELOG file. 2017-12-03 14:26:04 -02:00
Alexandre Arnt
98c91ae853 Merge pull request #302 from dkorzhevin/master
Small syntax fixes
2017-12-10 18:32:44 -02:00
Alexandre Arnt
a401e12573 Updated termwidget related code. 2017-12-10 18:15:08 -02:00
Dmytro Korzhevin
2f45944be4 Update release-translations.sh 2017-12-06 17:36:25 +02:00
Dmytro Korzhevin
76aa51fa2e Small syntax fixes 2017-12-06 17:29:33 +02:00
Alexandre Arnt
28d85c366a - Comment history change. 2017-12-03 17:45:10 -02:00
Alexandre Arnt
3e303ce310 Refactorings. 2017-12-03 17:23:55 -02:00
Alexandre Arnt
e08f7a8815 - Added Terminal dialog in Notifier (AUR update) if user compiles
project with libqtermwidget5 support.
2017-12-03 16:32:15 -02:00
Alexandre Arnt
91e559e35f - New class: TermWidget, extending QTermWidget. 2017-12-03 13:06:09 -02:00
Alexandre Arnt
5d6c5771cb - Added Terminal tab if user compiles project with libqtermwidget5
support.
2017-12-03 02:19:31 -02:00
Alexandre Arnt
24cb7b2eaf - Updated translations. 2017-11-30 15:33:58 -02:00
Alexandre Arnt
69fd73301b - Added initial QTermWidget testing;
- Fixed a string bug in parser.
2017-12-02 17:51:40 -02:00
Alexandre Arnt
3d6928a391 - Refresh UI on install local pkg. 2017-12-01 22:32:55 -02:00
Alexandre Arnt
f56bbbc168 - Comment debug code. 2017-12-01 17:15:18 -02:00
Alexandre Arnt
673167059c - BugFix in aur code. 2017-12-01 15:20:35 -02:00
Alexandre Arnt
365ddc48ea - New code to remove colors from strings. 2017-12-01 13:19:41 -02:00
Alexandre Arnt
cda91af947 - Refactorings in UnixCommand class;
- Trying to debug pacaur error;
2017-11-30 20:20:30 -02:00
Alexandre Arnt
2fb2266d96 - Updated translations. 2017-11-30 12:39:37 -02:00
Alexandre Arnt
0f77565fdb - BugFix: Infinite wait cursor in Cache Cleaner when user press Enter
for more than two seconds in the spin boxes.
2017-11-30 12:22:59 -02:00
Alexandre Arnt
05c03ebdec - Now we save outputdialog window size and position;
- Removed some buggy str from parser.
2017-11-29 13:16:25 -02:00
Alexandre Arnt
c346876f94 - BugFix: kcp refresh was not showing pkg numbers at statusbar
sometimes;
- Updated translations;
2017-11-29 11:26:54 -02:00
Alexandre Arnt
497cc66ea4 - BugFix in package list column code;
- BugFix: do not show backend tab in optionsdialog if we do not have
alpm compiled code.
2017-11-28 20:23:27 -02:00
Alexandre Arnt
dfddcdcdcb - Refactorings. 2017-11-28 16:06:13 -02:00
Alexandre Arnt
139f3642aa - Make AUR button disable whenever user chooses a pkg group. 2017-11-28 15:53:04 -02:00
Alexandre Arnt
b6aab3a315 - Instantsearch fixes. 2017-11-28 13:01:20 -02:00
Alexandre Arnt
329fae945d - Instantsearch changes. 2017-11-28 15:03:33 -02:00
Alexandre Arnt
d14bb8ea31 - Updated translations. 2017-11-28 12:39:20 -02:00
Alexandre Arnt
23f0205037 - Instantsearch fixes. 2017-11-28 12:27:34 -02:00
Alexandre Arnt
4ad97ac0a1 - instantsearch fixes. 2017-11-28 12:08:48 -02:00
Alexandre Arnt
2d6d0f76b4 - instantsearch fixes. 2017-11-28 12:02:40 -02:00
Alexandre Arnt
ca25f656cb - InstantSearch fixes. 2017-11-28 11:58:42 -02:00
Alexandre Arnt
1fbcb598ce - KCP needs diff treat. 2017-11-28 10:55:56 -02:00
Alexandre Arnt
67e2e1f246 - BugFix: When user selected another search option, line edit was not
being cleared.
2017-11-28 10:39:27 -02:00
Alexandre Arnt
bb8636c5ee - bugfix in instant search behaviour. 2017-11-27 19:07:43 -02:00
Alexandre Arnt
1f4cee54f6 - BugFix: kcp pkg listing was not being printed. 2017-11-27 17:58:04 -02:00
Alexandre Arnt
7cd00bbc05 - Updated translations. 2017-11-27 12:45:46 -02:00
Alexandre Arnt
08b7ec4999 - Trying to behave better in AUR searches. 2017-11-27 17:25:03 -02:00
Alexandre Arnt
e8779ccbf6 - BugFix: Notifier's about dialog was never screen centered. 2017-11-27 12:41:35 -02:00
Alexandre Arnt
f94457f12c - Updated translation. 2017-11-27 10:08:34 -02:00
Alexandre Arnt
e9c6174942 - Added support for ESC key to close cachecleaner;
- Refactorings in mainwindow code.
2017-11-27 11:52:41 -02:00
Alexandre Arnt
d6fcc3cf56 - UI fix. 2017-11-26 20:45:04 -02:00
Alexandre Arnt
b09b9de684 - Disable stop transaction when synching db finds pkgfile str. 2017-11-27 10:31:54 -02:00
Alexandre Arnt
ff118927ed - Updated README.md file. 2017-11-27 10:03:07 -02:00
Alexandre Arnt
c36eb4095d - Updated translations;
- Use pkg numbers and stop transaction button as default config.
2017-11-26 22:33:26 -02:00
Alexandre Arnt
50a8036f4d - BugFix: No tooltip in notifier when green icon. 2017-11-26 22:23:41 -02:00
Alexandre Arnt
930fc5ac77 - Updated translations. 2017-11-26 22:04:35 -02:00
Alexandre Arnt
fb0947ae7c - We only search for outdated AUR pkgs if the option is enabled. 2017-11-26 21:53:52 -02:00
Alexandre Arnt
967a6328f9 - Never show stop transaction button if no progress bar visible;
- Do not check for outdated AUR pkgs if we have outdated standard ones
in notifier.
2017-11-26 20:11:29 -02:00
Alexandre Arnt
8ae9b55214 - Arch BSD now is PacBSD. 2017-11-26 19:34:29 -02:00
Alexandre Arnt
be36c2937b - Updated translations. 2017-11-26 19:25:00 -02:00
Alexandre Arnt
0dde2ab86e - Updated README.md file. 2017-11-26 19:11:55 -02:00
Alexandre Arnt
d54d3d8cd0 - Updated README.md file. 2017-11-26 19:08:32 -02:00
Alexandre Arnt
22622a7d71 Merge branch 'master' of https://github.com/aarnt/octopi 2017-11-26 19:05:09 -02:00
Alexandre Arnt
e0817e2fb0 - Overhaul in distro url news feeds. 2017-11-26 19:04:38 -02:00
Alexandre Arnt
f3898716f3 - Updated translations. 2017-11-26 17:15:37 -02:00
Alexandre Arnt
4eaca6c9b3 - Let's PacmanExec determines when the stop transaction button can
appear.
2017-11-26 16:23:28 -02:00
Alexandre Arnt
f09bfc7003 - Removed Arming as a green word. 2017-11-26 15:51:27 -02:00
Alexandre Arnt
d5d756d82d - BugFix in OptionsDialog UI. 2017-11-26 15:24:06 -02:00
Alexandre Arnt
941aece11e - Group pane now spans all window's height. 2017-11-26 14:49:05 -02:00
Alexandre Arnt
21953d09d4 - BugFix: Opens file selector in current file path. 2017-11-26 14:26:45 -02:00
Alexandre Arnt
9e4fa4b7a3 - BugFix: repoeditor now runs as normal user and asks for root password
on save;
- Added stop transaction button in notifier;
- BugFix: Forbid repoeditor root running.
2017-11-26 14:14:48 -02:00
Alexandre Arnt
347bd0ceb1 - Added option to enable/disable search for outdated AUR pkgs;
- Fixes in AUR code;
2017-11-25 19:27:37 -02:00
Alexandre Arnt
b8747195ed - Added General tab in optionsdialog code.
- BugFix in pkg counters code.
2017-11-25 16:33:20 -02:00
Alexandre Arnt
8800c47f55 - Updated translation;
- BugFix: new image.
2017-11-25 12:14:53 -02:00
Alexandre Arnt
e9773c1c86 - Added button after progressbar to stop current running transaction;
- BugFix: never let pkgcounter value be higher than numberofpkgs.
2017-11-25 12:01:22 -02:00
Alexandre Arnt
5289caadff - Returned to previous 'terminate transaction' code. 2017-11-25 02:06:41 -02:00
Alexandre Arnt
dd04860401 - Parser changes: added counter for processed packages.
- BugFix in optionsdialog code.
2017-11-25 01:33:50 -02:00
Alexandre Arnt
eed57cf144 - Added option to remove pacman db lock from notifier. 2017-11-20 19:30:17 -02:00
Alexandre Arnt
6e0ebe9fc0 - Get the info about instant search at loadSettings. 2017-11-20 18:07:06 -02:00
Alexandre Arnt
404a156f2b - Added "Search/Use Instant Search" toggle. 2017-11-20 17:39:30 -02:00
Alexandre Arnt
a699915ea7 - BugFixes in cancelProcess code. 2017-11-20 15:46:30 -02:00
Alexandre Arnt
fbc4b54811 - Do not sync nor upgrade in notifier if pacman db is locked. 2017-11-20 12:31:10 -02:00
Alexandre Arnt
a4de722874 - Reverted lineedit focus. 2017-11-20 12:12:48 -02:00
Alexandre Arnt
c82f3c02fc - BugFix: After outdated AUR pkg check, the pkg list lost current index
info.
2017-11-20 12:10:37 -02:00
Alexandre Arnt
17101da9b2 - BugFix: System upgrade shortcut changed to "ctrl+P" as "ctrl+U" is
used to cut text in QLineEdit widgets.
2017-11-20 11:25:54 -02:00
Alexandre Arnt
ccb1418a34 - Removed unused qml file. 2017-11-19 23:39:05 -02:00
Alexandre Arnt
0864632d9e - Changed most of "RegExp" code to "RegularExpression".
- BugFix: If Notifier hid Octopi and was closed, Octopi's window would
stay hidden.
2017-11-19 23:07:43 -02:00
Alexandre Arnt
7ca2f7e93e - BugFix: Anchor description was not working when there was a "<" char;
- BugFix: Reworked drag code;
- BugFix: orange strings must be caught before green ones!
2017-11-17 10:05:35 -02:00
Alexandre Arnt
be162818cb - Added support fo drag pacman packages to Octopi's mainwindow so they
can be installed.
2017-11-16 23:03:16 -02:00
Alexandre Arnt
a1759d85fa - BugFix for aurupgrade message. 2017-11-16 22:06:21 -02:00
Alexandre Arnt
af32397c04 - Added option to upgrade outdated foreign packages from Octopi
Notifier.
2017-11-16 20:49:22 -02:00
Alexandre Arnt
d74618d332 - Better way to kill running pacman transaction. 2017-11-16 16:09:50 -02:00
Alexandre Arnt
5c9be7cbd1 - Removed cleanCache (ctrl+shift+C) command, as we have octopi-cache-
cleaner for that!
2017-11-16 15:40:07 -02:00
Alexandre Arnt
4121c1e2a9 - BugFix: AUR tab in optionsdialog should honor which tool is installed
and disables it when not.
2017-11-16 15:34:03 -02:00
Alexandre Arnt
11fd4530ce - BugFix: When no AUR helper exists, the group of packages panel stayed
disabled.
2017-11-16 14:20:22 -02:00
Alexandre Arnt
b456284f75 - BugFix: Cache Cleaner now saves its window geometry. 2017-11-15 22:55:10 -02:00
Alexandre Arnt
122ae6a6ff - If we do not have more than 1 terminal, we do not show option to
change it.
2017-11-15 22:31:14 -02:00
Alexandre Arnt
e09727b56d - Updated translations 2017-11-15 22:15:10 -02:00
Alexandre Arnt
10c114a867 - Bugfixes when dealing with outdated aur pkgs. 2017-11-15 20:08:59 -02:00
Alexandre Arnt
a6bcf4ddbf - BugFix: Every time we change AUR tool we must refresh notifier icon. 2017-11-15 19:29:24 -02:00
Alexandre Arnt
b7936681cf - Add option to do not use an AUR tool. 2017-11-15 19:19:12 -02:00
Alexandre Arnt
e232c0bb5e - BugFix: check box too small. 2017-11-15 13:40:52 -02:00
Alexandre Arnt
e235be9895 - Added "pacman" info at Notifier's about dialog. 2017-11-15 13:35:11 -02:00
Alexandre Arnt
95d5debfee - Added configurable "--noconfirm" and "--noedit" options to pacaur and
"--noconfirm" to yaourt.
2017-11-15 13:21:54 -02:00
Alexandre Arnt
a274a3d9ae - Added "ctrl+Z" to cancel running transaction;
- BugFix: crash when sysupgrading with pacman lock file.
2017-11-14 17:11:04 -02:00
Alexandre Arnt
51e8d51562 - Code cleanup. 2017-11-14 12:09:53 -02:00
Alexandre Arnt
3ddf0118fc - Changed F12 behaviour to F11 key. 2017-11-14 11:56:26 -02:00
Alexandre Arnt
31f980ff4f - UI string fix. 2017-11-13 11:42:43 -02:00
Alexandre Arnt
dfb0dbfa90 - Updated translations. 2017-10-10 12:33:01 -03:00
Alexandre Arnt
9d566cc6c1 Merge pull request #297 from bwendell/master
Open Octopi if left click on SystemTray icon
2017-10-10 12:23:19 -03:00
Alexandre Arnt
0c2d4dddd5 Merge pull request #298 from totte/master
Update utils.cpp with the new address for the Chakra RSS feed
2017-09-08 13:14:39 -03:00
totte
e34c251523 Update utils.cpp with the new address for the Chakra RSS feed 2017-09-08 14:38:24 +02:00
Benjamin Wendell
8325cb6b43 Open Octopi if left click on SystemTray icon 2017-09-06 15:44:13 -07:00
Alexandre Arnt
7eead7588d - Updated translations. 2017-08-22 11:54:35 -03:00
Alexandre Arnt
ae100280e3 Merge branch 'master' of https://github.com/aarnt/octopi 2017-08-22 11:52:14 -03:00
Alexandre Arnt
5b951aac4f - Remove test code. 2017-08-22 11:51:42 -03:00
Alexandre Arnt
ff5cdadf4d Merge pull request #268 from bwendell/master
Remove empty error box in CacheCleaner
2017-08-21 10:56:25 -03:00
Alexandre Arnt
1e669d08a0 Merge pull request #295 from txe/fix-issue-235
BugFix: no outdated AUR packages detected
2017-08-21 10:55:35 -03:00
Evgenii Guryanov
c5ae8d2980 BugFix: no outdated AUR packages detected 2017-08-19 13:37:43 +03:00
Benjamin Wendell
ec8f49b0d7 Remove empty error box 2017-08-05 18:26:52 -07:00
Alexandre Arnt
a1b0a5ec97 - Updated translations. 2017-06-29 13:33:15 -03:00
Alexandre Arnt
487c80b475 - Updated translations. 2017-06-20 17:19:44 -03:00
Alexandre Arnt
cec926a090 - BugFix: squashed a warning compiling with clang :) 2017-06-16 13:56:18 -03:00
Alexandre Arnt
23623f9cee - Updated translations. 2017-06-16 10:58:25 -03:00
Alexandre Arnt
f92aa3426c - BugFix: sync packages was disabled when returnig to pkg list after
clicking AUR button.
2017-06-14 15:14:41 -03:00
Alexandre Arnt
989617366a - We must maintain "else" clause in case ALPM stop working. 2017-06-14 10:58:39 -03:00
Alexandre Arnt
96324d4595 - Removed unused strs. 2017-06-14 10:41:22 -03:00
Alexandre Arnt
17ba947380 - Updated translations. 2017-06-14 10:26:32 -03:00
Alexandre Arnt
bab0aa8ebc - Fix in aur refresh list. 2017-06-13 17:59:12 -03:00
Alexandre Arnt
b44226bea7 - Updated project file. 2017-06-13 12:55:51 -03:00
Alexandre Arnt
d56ebd1ff9 - Updated translations. 2017-06-13 10:52:22 -03:00
Alexandre Arnt
e034d1bf03 - BugFix in enable/disable action code. 2017-06-12 18:04:53 -03:00
Alexandre Arnt
e99ae35661 - Update translations. 2017-06-12 17:39:45 -03:00
Alexandre Arnt
d283de66b5 - BugFix in OptionsDialog text. 2017-06-12 17:16:20 -03:00
Alexandre Arnt
4d690d6ca8 - Bugfix in translatable text. 2017-06-12 15:42:33 -03:00
Alexandre Arnt
604ab88b09 - Added SU tool value analysis on startup. 2017-06-09 12:54:23 -03:00
Alexandre Arnt
cad306b6de - Implement "AUTOMATIC" for SU Tool value. 2017-06-09 11:21:30 -03:00
Alexandre Arnt
6363f7c386 - BugFix in OptionsDialog code. 2017-06-08 23:21:12 -03:00
Alexandre Arnt
c8abdc6343 - Bugfix in OptionsDialog. 2017-06-08 22:58:33 -03:00
Alexandre Arnt
9a12e9831b - Fixed KAOS condition. 2017-06-08 22:49:55 -03:00
Alexandre Arnt
d470485c49 - Removed unused code. 2017-06-08 22:40:30 -03:00
Alexandre Arnt
ad292fa496 - Added code for SU tool tab in OptionsDialog. 2017-06-08 22:31:47 -03:00
Alexandre Arnt
0f4cb05418 - Add more tabs to OptionsDialog. 2017-06-08 18:09:49 -03:00
Alexandre Arnt
3f3fb1e2ab - Removed some unused defines. 2017-06-07 14:37:48 -03:00
Alexandre Arnt
fc44e72bb1 - Fix for strconstants.cpp in pro files. 2017-06-07 10:27:44 -03:00
Alexandre Arnt
de915f748f - Add strconstants.cpp to project. 2017-06-06 12:12:26 -03:00
Alexandre Arnt
968f1f213d - Fix for string loss (in certain locales) in installation.log. 2017-05-16 13:01:09 -03:00
Alexandre Arnt
19eb70e425 - Fix for pacaur outdated list. 2017-05-05 15:08:08 -03:00
Alexandre Arnt
e5544644a7 Merge pull request #234 from flying-sheep/unicode-arrows
switched “->” to “→”
2017-05-04 13:17:54 -03:00
Philipp A
8781c23939 switched “->” to “→” 2017-05-04 10:32:13 +02:00
Alexandre Arnt
8e89cae659 - removed unused include. 2017-05-01 21:57:32 -03:00
Alexandre Arnt
a22f80c053 - Refactored method. 2017-05-01 18:51:08 -03:00
Alexandre Arnt
9a1d042fb8 - BugFix: 'yaourt' and 'pacaur' no longer honor "-a" option when
querying outdated foreign packages;
- Refactored getForeignRepositoryToolName method.
2017-05-01 18:44:10 -03:00
Alexandre Arnt
f7dbf97c53 - Useless assignment. 2017-04-29 23:18:20 -03:00
Alexandre Arnt
eb34d25272 - BugFix: No tools menu was shown when no tools available, but there was
'Options'!
2017-04-29 22:32:59 -03:00
Alexandre Arnt
d6a8313a19 - Modified KDE code for searchlineedit style sheet. 2017-04-18 17:44:21 -03:00
Alexandre Arnt
1020f7a498 - Updated CHANGELOG. 2017-04-18 15:29:48 -03:00
Alexandre Arnt
4232475053 - Updated some translations. 2017-04-18 15:11:47 -03:00
Alexandre Arnt
42d4126a5d Merge pull request #225 from mbb78/master
Change font family from "sansserif" to "Sans Serif"
2017-02-28 22:44:14 -03:00
Luís Coimbra
aa9f71cfd7 Change font family from "sansserif" to "Sans Serif"
Issue #222: Font family "sansserif" creates a conflict with Microsoft's font "SansSerif" if installed. Qt is unable to draw this font because of a bad cmap table. Aliases and substitutions by using fontconfig don't work, only blacklisting. Working formats include "sans serif" and "sans-serif". I went with "Sans Serif" to stay coherent with the patch applied by Manjaro Team.
2017-02-28 22:15:47 +00:00
Alexandre Arnt
18bccb8e5b - Find line edit is always focused when the program starts. 2017-02-22 17:16:06 -03:00
Alexandre Arnt
e3576c31a3 - BugFix: Forgot to call alpm_utils free code in alpmbackend.cpp.
- Removed unused notifier code.
2017-01-17 12:10:49 -02:00
Alexandre Arnt
53f06c0382 - BugFix: System upgrade button was not disabled while synching packages
in notifier;
- BugFix: searchlineedit font fix.
2017-01-12 14:57:22 -02:00
Alexandre Arnt
cfad0498b8 Merge pull request #215 from aarnt/revert-210-outputdialog-ui
Revert "Created ui file for OutputDialog"
2017-01-11 18:22:43 -02:00
Alexandre Arnt
24e3ad5ed5 Revert "Created ui file for OutputDialog" 2017-01-11 18:22:07 -02:00
Alexandre Arnt
7a2abbc325 Merge pull request #210 from flying-sheep/outputdialog-ui
Created ui file for OutputDialog
2017-01-11 13:31:24 -03:00
Alexandre Arnt
30adc49bc0 Merge branch 'master' into outputdialog-ui 2017-01-11 13:31:14 -03:00
Alexandre Arnt
c9cbafcf40 - Code cleanup at OptionsDialog. 2016-12-21 16:59:37 -02:00
Alexandre Arnt
80d5fed085 - Suppress translations of some interface itens. 2016-12-20 17:53:27 -02:00
Alexandre Arnt
d3a1a4bf1b - Added some comments in OptionsDialog. 2016-12-20 15:11:21 -02:00
Philipp A
b7560ca07b extracted more to UI files 2016-12-17 12:46:52 +01:00
Alexandre Arnt
0f814c8e16 - Updated OptionsDialog code. 2016-12-16 21:03:15 -02:00
Alexandre Arnt
e864ea1999 - Updated OptionsDialog code.
- Now Notifier calls OptionsDialog instead of SetupDialog.
2016-12-16 17:52:59 -02:00
Philipp A
89d47bf147 created ui file for OutputDialog 2016-12-16 19:29:07 +01:00
Alexandre Arnt
9929836cc4 - Updated OptionsDialog code. 2016-12-16 12:43:19 -02:00
Alexandre Arnt
0b31ebdee6 - Updated Options Dialog code.
- Added Tools/Options menu entry.
2016-12-15 18:00:20 -02:00
Alexandre Arnt
ff25031d1e - Updated Options Dialog code. 2016-12-14 18:02:19 -02:00
Alexandre Arnt
4a540cfd7b - Updated code in OptionsDialog. 2016-12-13 17:33:42 -02:00
Alexandre Arnt
bf39bfe921 - Added new OptionsDialog class/UI. 2016-12-12 17:22:59 -02:00
Alexandre Arnt
b95a8f985e - Changed default values in CacheCleaner. 2016-12-02 16:12:24 -02:00
Alexandre Arnt
144c3f2ed7 Merge pull request #205 from tsujan/fix_lxqt
Use lxqt-sudo under LXQt
2016-11-10 11:57:07 -02:00
Tsu Jan
bc5a017695 Use lxqt-sudo under LXQt
Fixes https://github.com/aarnt/octopi/issues/204.
2016-10-25 16:34:47 +03:30
Alexandre Arnt
0cff45f88c Merge branch 'master' of https://github.com/aarnt/octopi 2016-10-22 21:28:21 -02:00
Alexandre Arnt
b54f6904d4 - BugFix: Let's not forget the important "break" statement in switches,
so Octopi icons can change color.
2016-10-22 21:27:58 -02:00
Alexandre Arnt
7a2e7850ad Merge pull request #202 from scachemaille/patch-1
Make KSTATUS works with ALPM_BACKEND addition
2016-10-17 16:21:30 -02:00
Alexandre Arnt
4d0bc6caa9 - Fixed method name bug. 2016-10-17 07:11:11 -02:00
Alexandre Arnt
13bb6b516a - Updated code for App icon. 2016-10-16 21:31:19 -02:00
Stéphane
872d5fc7f7 Make KSTATUS works with ALPM_BACKEND addition
Makes KSTATUS definiton works with the addition of ALPM_BACKEND definition in the project file
2016-10-17 00:29:34 +02:00
Alexandre Arnt
13e19d0c16 - BugFix: Use right object to test AUR package size;
- Added Config Dialog core methods.
2016-10-16 16:05:16 -02:00
Alexandre Arnt
1d334f5e27 Merge branch 'master' of https://github.com/aarnt/octopi 2016-10-16 11:24:35 -02:00
Alexandre Arnt
a8e998993c BugFix: Whenever user syncs databases (notifier included), we set new
lastsynctime value in .conf.
2016-10-16 11:23:55 -02:00
Alexandre Arnt
dfaa9b0a00 Update README.md
Fixed ArchBang web site.
2016-10-13 13:09:19 -03:00
Alexandre Arnt
9b34e85cea - Removed a refresh code. 2016-10-03 11:21:17 -03:00
Alexandre Arnt
22f8b2b12f - Removed alpm_octopi_utils line. 2016-09-26 16:03:14 -03:00
Alexandre Arnt
cdea76dd14 - Notifier: Removed unneeded division from upgrade size. 2016-09-26 15:17:47 -03:00
Alexandre Arnt
88bee2da43 Merge pull request #199 from demmm/master
Move autostart to octopi-notifier.pro
2016-09-26 14:34:57 -03:00
demmm
e5b27d290b move autostart to octopi-notifier.pro 2016-09-26 12:21:39 -04:00
demmm
3cc847e532 Merge pull request #2 from aarnt/master
merge master
2016-09-26 16:18:12 +00:00
Alexandre Arnt
b97a2bbb6d - Moved .desktop file to correct place. 2016-09-26 13:05:24 -03:00
Alexandre Arnt
b390774d1b - Removed "Version 5.3" test in ".pro". 2016-09-26 12:46:04 -03:00
Alexandre Arnt
112e2783f8 Merge pull request #190 from demmm/master
Update build files
2016-09-26 12:27:07 -03:00
Alexandre Arnt
d69961746d - Added a separator "\". 2016-09-26 12:12:52 -03:00
demmm
494cb645bd license is gpl 2.0 2016-09-26 11:08:30 -04:00
Alexandre Arnt
2b1c527171 Update README.md
Update qmake to qmake-qt5
2016-09-26 10:37:01 -03:00
demmm
695b1ad660 move the .desktop install to the respective pro files 2016-09-26 01:46:06 -04:00
demmm
97d244cb4c add install section to all .pro files
remove lib section & most of bin section from octopi.pro
adjust PKGBUILD to use make install in each subdir
cp the needed .png in prepare, or ship in the resources dir?
2016-09-26 01:32:07 -04:00
Alexandre Arnt
a91978941d Updated README instructions 2016-09-25 15:40:21 -03:00
Alexandre Arnt
6564a2cebd Updated README instructions 2016-09-25 15:39:27 -03:00
Alexandre Arnt
2d1fe16358 Updated README instructions 2016-09-25 15:38:18 -03:00
demmm
56e1d5577c add octopi.png to pro file for install 2016-09-25 12:22:47 -04:00
demmm
67a4a6d85d adjusted PKGBUILD 2016-09-25 12:11:58 -04:00
demmm
a8bc660efa Merge pull request #1 from aarnt/master
Merge upstream changes
2016-09-25 15:51:18 +00:00
Alexandre Arnt
74d6b88fb0 - Added link support in all package lists at Info tab;
- BugFix: implement ALPM backend in notifier.
2016-09-25 12:36:05 -03:00
Alexandre Arnt
7b464f2f2e - Fix doc. 2016-09-24 22:10:42 -03:00
Alexandre Arnt
e43ceb07cc - Updated translations. 2016-09-24 22:03:54 -03:00
demmm
5f23e1bbd6 added install section to octopi.pro
this means package section in PKGBUILD is complete simplified
2016-09-02 18:06:00 -04:00
demmm
b6e53777bd Not a GTK app
Make it a generic desktop entry, not Gnome specific
Might need testing if this still works on a Gnome install
2016-09-01 17:51:12 -04:00
demmm
271c7e191f Update octopi.install
Remove parts that are replaced with pacman hooks
correct the remove systemctl call
2016-09-01 17:48:42 -04:00
demmm
ef2589b73b Redo PKGBUILD
Ship as one complete app
Remove obsolete startdir refs
Add knotifications & alpm_octopi_utils depends, show in the optional sed lines they can be removed
add system as group
stable release build does not have a git depend
2016-09-01 17:46:33 -04:00
Alexandre Arnt
a45ca53c2e - Moved alpm_octopi_utils to its own repository. 2016-08-31 18:13:40 -03:00
Alexandre Arnt
6b57c75bd6 - Add AUTHORS file. 2016-08-31 17:46:12 -03:00
Alexandre Arnt
014ef652ff - Added new subproject alpm_octopi_utils. 2016-08-31 17:36:03 -03:00
Alexandre Arnt
eeefd39035 - BugFix: Pkg Column width save/restore code. 2016-08-29 16:10:40 -03:00
Alexandre Arnt
a76e2daa0a - Added support for building the pkg list with alpm lib (plus a new
Download size column).
2016-08-28 21:01:49 -03:00
Alexandre Arnt
c33bbd30c6 - BugFix: Some pkg download/installed sizes were not showing properly at
Info tab.
2016-08-26 23:20:51 -03:00
Alexandre Arnt
1e7bbed24b - BugFix: If we find an outdated AUR pkg in the official pkg list, we
remove it.
2016-08-24 22:51:24 -03:00
Alexandre Arnt
37629fa69b - BugFix: If we find an outdated AUR pkg in the official pkg list, we
remove it.
2016-08-24 22:06:02 -03:00
Alexandre Arnt
51759fa6dd - BugFix: Using the alpm algorithm for package version comparison.
Previous code was reporting false newer packages.
2016-08-24 12:18:43 -03:00
Alexandre Arnt
deaa0f8911 Merge pull request #186 from Oxalin/master
Add an AUR filter submenu
2016-08-24 10:43:30 -03:00
Alexandre Demers
922b042914 Add an AUR filter submenu
Signed-off-by: Alexandre Demers <alexandre.f.demers@gmail.com>
2016-08-23 23:27:53 -04:00
Alexandre Arnt
12c1295761 Merge pull request #185 from AlmAck/master
removed "--nofork" and "-c" option
2016-08-23 18:09:00 -03:00
AlmAck
7326de54c6 removed the "-c" option, pass directly the file with the instructions 2016-08-22 19:52:48 +02:00
AlmAck
9a6a03cf79 removed "--nofork" parameter, removed upstream with konsole >=16.08.0 2016-08-22 19:50:44 +02:00
Alexandre Arnt
cdea9b37a3 Merge pull request #184 from totte/master
Update source with the new address for Chakra
2016-08-22 12:18:09 -03:00
H W Tovetjärn
6e50e5adcb Update utils.cpp with new address for Chakra
The new address is chakralinux.org
2016-08-22 17:13:43 +02:00
H W Tovetjärn
ebb5aecc82 Update README.md with new address for Chakra
It's chakralinux.org now, rather than chakraos.org
2016-08-22 17:11:42 +02:00
Alexandre Arnt
b4c825b9c9 Merge pull request #182 from Pilzschaf/fix-issue-#180
Fix issue #180 shows the user a message box when close event is ignored
2016-08-18 15:58:39 -03:00
pilzschaf
e53d10d736 Improved indentation of code 2016-08-18 19:10:46 +02:00
pilzschaf
2701df7a9b Added message box when user tries to close octopi when there is a command executing. Fixes issue #180 2016-08-18 19:04:33 +02:00
Alexandre Arnt
f07959e06b BugFix: Install local packages did not work with space separated paths
(thanks to voanhcuoc for pointing it out).
2016-08-13 22:32:07 -03:00
Alexandre Arnt
9e710f3ec7 - Updated Croatian translation;
- Added default english translation to minimize translation work when
fixing string bugs;
2016-08-13 21:50:24 -03:00
Alexandre Arnt
28777174bc - BugFix: Optional dependencies dialog can now be resized and new value
is persisted on disk.
2016-08-06 19:31:09 -03:00
Alexandre Arnt
8fd614e8ca Merge branch 'master' of https://github.com/aarnt/octopi 2016-08-06 18:50:06 -03:00
Alexandre Arnt
2978da8b46 - Updated translations;
- BugFix: Max time in minutes for notification interval was not honoring
> 1380.
2016-08-06 18:49:29 -03:00
Alexandre Arnt
dfdb01424a Merge pull request #174 from philmmanjaro/patch-2
- Updated Manjaro RSS site
2016-07-30 08:45:01 -03:00
Philip Müller
632e58de8f - Updated Manjaro RSS site 2016-07-30 11:15:11 +02:00
Alexandre Arnt
752e52f75e - Added slovenian translation (thanks to the translation crew);
- Updated ukrainian translation.
2016-07-17 15:39:53 -03:00
Alexandre Arnt
ec6349230b - BugFix: Whenever we get a "pkgX: requires pkgY" upgrade bug, we show
the terminal to the user.
2016-07-17 15:22:21 -03:00
Alexandre Arnt
bb4512614b - Tries to do a manual sysupgrade when "pacman -Spu" prints a "breaks
dependency" string.
2016-06-26 19:09:33 -03:00
Alexandre Arnt
59140395e9 Merge pull request #171 from ccr-tools/master
Replace ccr with chaser
2016-06-08 15:08:45 -03:00
Alexandre Arnt
d051250a57 - Updated KaOS RSS site. 2016-06-08 15:05:22 -03:00
rshipp
a3687cbd21 Replace ccr with chaser 2016-06-06 19:12:45 -06:00
Alexandre Arnt
468fcd881c Merge pull request #168 from flying-sheep/noframe
Remove frame on output dialog
2016-05-25 21:24:08 -03:00
Philipp A
34f7ddd3bd Removing frame on output dialog 2016-05-25 09:56:45 +02:00
Alexandre Arnt
dea7426857 - Speed up the method. 2016-05-08 21:21:26 -03:00
Alexandre Arnt
fb117c4a65 - BugFix: Do not let some keys work when running a transaction... 2016-05-07 18:38:15 -03:00
Alexandre Arnt
8ca633171a - Added "Install Reason" field at Info tab;
- Prevent the user to install partial upgrades in his system (some of
the outdated packages).
2016-05-07 18:30:48 -03:00
Alexandre Arnt
c43008fed5 - Updated translations. 2016-05-05 22:51:50 -03:00
Alexandre Arnt
4a03666e82 - Another dev cycle begins...
- BugFix: About and System Upgrade dialogs could be opened twice in
notifier.
2016-04-08 19:04:15 -03:00
Alexandre Arnt
6d92b42636 Update README.md
Fixed wrong url in README.
2016-03-31 11:05:09 -03:00
Alexandre Arnt
0d98280272 - Bugfix in groups code. 2016-03-27 16:54:26 -03:00
Alexandre Arnt
9fa9190813 - Added ccr to getAUR URL code. 2016-03-27 12:36:15 -03:00
Alexandre Arnt
2557f971fe - Bugfix in url aur code. 2016-03-27 12:13:10 -03:00
Alexandre Arnt
fa3b31a7ac - Bugfix in url show code. 2016-03-27 12:07:42 -03:00
Alexandre Arnt
4454ed520f - Add AUR pkg URL information at Info tab. 2016-03-27 11:59:13 -03:00
Alexandre Arnt
3fabfcda1c - BugFix: Whenever a pkg is called "sh" in optional list, let's anchor
it to "bash".
2016-03-27 10:55:03 -03:00
Alexandre Arnt
6e0debe014 - Bugfixes in groups code. 2016-03-27 10:06:17 -03:00
Alexandre Arnt
739c336a78 - Removed useless code. 2016-03-27 09:04:22 -03:00
Alexandre Arnt
96b06ca89f - Bugfix in toolbutton code. 2016-03-27 08:52:33 -03:00
Alexandre Arnt
002b207fcc - Let's refresh AUR tool button just in the main package list screen. 2016-03-27 08:07:44 -03:00
Alexandre Arnt
6034fc7ac9 - Optimize code. 2016-03-26 12:16:58 -03:00
Alexandre Arnt
d45645bb7c - Bugfix in buildPackageList. 2016-03-26 12:12:36 -03:00
Alexandre Arnt
c0bed628d2 - BugFix in pkglist method. 2016-03-26 12:09:26 -03:00
Alexandre Arnt
742ce81bce - Package list now also preserves sort column and sort order while in
AUR/KCP/CCR mode.
2016-03-26 11:19:19 -03:00
Alexandre Arnt
9596adc9c3 - Bugfix to comply to new pacaur tool;
- Preparation for release.
2016-03-25 23:06:00 -03:00
Alexandre Arnt
28a7f96f78 - Added <F2> shortcut to focus package list. 2016-03-25 20:00:21 -03:00
Alexandre Arnt
89de8dcc62 - Fixed a crash in anchor click while package list did not have focus. 2016-03-25 18:39:44 -03:00
Alexandre Arnt
1115b0e345 - BugFix: When user commits a transaction, commit and cancel buttons
must get disabled.
2016-03-24 20:23:58 -03:00
Alexandre Arnt
ed557f5677 - Use DELETE key to remove pkgs. 2016-03-24 19:34:51 -03:00
Alexandre Arnt
8573e748c2 - Added a shortcut to repoeditor. 2016-03-20 18:29:28 -03:00
Alexandre Arnt
76df1ffb28 - Added shortcuts to some tools. 2016-03-20 12:29:38 -03:00
Alexandre Arnt
ac922ca980 - Small fixes. 2016-03-20 10:43:36 -03:00
Alexandre Arnt
4922e18a1a - Pressing <ENTER> or <RETURN> key on package list triggers package
actions.
2016-03-20 10:31:22 -03:00
Alexandre Arnt
d3c89e293b - Make Octopi more keyboard friendly;
- Some refactorings.
2016-03-20 00:04:21 -03:00
Alexandre Arnt
66fd0746ba - Forgot header info. 2016-03-12 19:05:05 -03:00
Alexandre Arnt
2e45b25cc6 - Refactor in debug mode. 2016-03-12 19:02:49 -03:00
Alexandre Arnt
390cfdc1c5 - Refactoring in remove AUR pkg in a kcp environment. 2016-03-12 18:11:01 -03:00
Alexandre Arnt
3bfa9a1c09 - BugFix: removing AUR pkgs with ccr and kcp were buggy. 2016-03-12 17:37:11 -03:00
Alexandre Arnt
97e63a7b2a - Warn for plasma5 systems using notifier code. 2016-03-12 12:20:20 -03:00
Alexandre Arnt
881b80ad1e - Enhance debugmode output. 2016-03-12 11:54:50 -03:00
Alexandre Arnt
dd09f19d8a - Stop using 'notify-send' in octopi-notifier: the era of annoying
notifiers is over;
- Updated translations.
2016-03-12 10:23:43 -03:00
Alexandre Arnt
1829a288be - Back to defaulting to qt4 for notifier (PKGBUILD). 2016-03-03 17:22:42 -03:00
Alexandre Arnt
aeddfc5816 - Tries to keep notifier compatible with Qt4 libs. 2016-03-03 17:10:04 -03:00
Alexandre Arnt
d1c52c07f1 - Tries to keep notifier compatible with Qt4. 2016-03-03 17:06:17 -03:00
Alexandre Arnt
5a27a68d29 - Use only Qt5 in PKGBUILD. 2016-03-03 15:48:09 -03:00
Alexandre Arnt
2c629c7fcc - BugFix in cache cleaner .pro file. 2016-03-03 14:31:32 -03:00
Alexandre Arnt
f34408cf11 - OutputDialog: first add progressBar. 2016-03-03 12:27:39 -03:00
Alexandre Arnt
e3ccd48c17 - BugFix in get AUR pkg list. 2016-03-03 12:00:45 -03:00
Alexandre Arnt
9827c4231a - BugFix in Get AUR package list. 2016-03-03 11:53:47 -03:00
Alexandre Arnt
9765d48bda - BugFix in makeAnchorOfPackage code. 2016-03-03 11:32:26 -03:00
Alexandre Arnt
b459545aa2 - Refactor to make code generic. 2016-03-03 10:41:57 -03:00
Alexandre Arnt
63cf13150a - Fix in action code. 2016-03-02 21:29:40 -03:00
Alexandre Arnt
e7dddc4b65 - BugFix: test action before seting value. 2016-03-02 21:24:44 -03:00
Alexandre Arnt
2214b1ea40 - Fix outputdialog code. 2016-03-02 18:37:11 -03:00
Alexandre Arnt
92bab445f4 - Missed command execute flag. 2016-03-02 18:18:39 -03:00
Alexandre Arnt
8cc5ef5b76 - Fix slot parameter. 2016-03-02 18:11:02 -03:00
Alexandre Arnt
e034267666 - BugFix in slot parameter. 2016-03-02 18:08:15 -03:00
Alexandre Arnt
71bb830f46 - BugFix in slot parameters. 2016-03-02 18:06:10 -03:00
Alexandre Arnt
0504431389 - Forgot to lock notifier interface... 2016-03-02 18:01:47 -03:00
Alexandre Arnt
9709ce3486 - BugFix in notifier code. 2016-03-02 17:43:34 -03:00
Alexandre Arnt
db87a8f904 - Changed some headers. 2016-03-02 17:35:01 -03:00
Alexandre Arnt
559c025832 - Fix. 2016-03-02 17:02:37 -03:00
Alexandre Arnt
f0af41bfb3 - Add another include. 2016-03-02 17:00:21 -03:00
Alexandre Arnt
28560aca23 - Those files missed default project header. 2016-03-02 16:06:26 -03:00
Alexandre Arnt
08a62b466a - Updated translations. 2016-03-02 15:57:51 -03:00
Alexandre Arnt
f1ef4fa4c0 - Oooops :-) 2016-03-02 15:52:22 -03:00
Alexandre Arnt
93cc403567 Merge branch 'master' of https://github.com/aarnt/octopi 2016-03-02 15:50:32 -03:00
Alexandre Arnt
800cd164e8 - Major refactoring: Decoupling of Pacman executor and parser code from
the UI as well as SearchBar slots for QTextBrowser objects;
- Added an output dialog to notifier, so users can do a system upgrade
without a terminal.
2016-03-02 15:50:06 -03:00
Alexandre Arnt
0c1deb4c22 - Major refactoring: Decoupling of Pacman executor and parser code from
the UI as well as SearchBar slots for QTextBrowser objects;
- Added an output dialog to notifier, so users can do a system upgrade
without a terminal.
2016-03-02 15:47:08 -03:00
Alexandre Arnt
d81bf0e28d - spaces... 2016-03-01 19:02:35 -03:00
Alexandre Arnt
8344157840 - BugFix: When you were searching for a pkg and the Files tab was
selected, focus got lost;
- BugFix: Package dependencies with >, <, =, >= and <= signals were not
clickable in Info tab;
- Major refactoring: Decoupling of Pacman executor and parser code from
the UI.
2016-03-01 19:01:04 -03:00
Alexandre Arnt
a114840c3c - BugFix: When there's a pkg change outside Octopi, we trigger a flag to
refresh the lists.
2016-02-28 18:16:17 -03:00
Alexandre Arnt
d360d3a150 - Updated translation. 2016-02-28 14:31:37 -03:00
Alexandre Arnt
17fa8e7c04 - Updated translations. 2016-02-27 19:07:26 -03:00
Alexandre Arnt
6c0d32b401 - BugFix: Do not permit two or more octopi instances if one is in root
mode.
2016-02-27 15:37:56 -03:00
Alexandre Arnt
1a6f05a107 - Adjusted notifier to handle 1 month check intervals. 2016-02-27 15:22:18 -03:00
Alexandre Arnt
7002ed6471 - BugFix in run with root mode;
- BugFix: Got rid of that annoying ampersand in mainwindow.ui.
2016-02-27 15:02:30 -03:00
Alexandre Arnt
6d20a2817b - BugFix: Tab files was not refreshing when enabling KCP mode in KaOS. 2016-02-26 19:31:23 -03:00
Alexandre Arnt
6137cd17c7 - Added an entry for Mirror-check in Tools menu. 2016-02-26 17:55:44 -03:00
Alexandre Arnt
ceb8afca9f - Added an entry for Mirror-check in File menu;
- Added "pkgfile -u" (if available) in sync db transaction.
2016-02-26 16:57:16 -03:00
Alexandre Arnt
36c68e9567 - BugFix: Distro news now works with https KaOS site. 2016-02-25 16:48:42 -03:00
Alexandre Arnt
d1515168a5 - Updated README.md file. 2016-02-07 15:44:15 -02:00
Alexandre Arnt
2f32ea859f - Removed mirror-check from Chakra. 2016-02-06 18:16:39 -02:00
Alexandre Arnt
402bc37847 - Added Calamares install log when in KaOS. 2016-02-06 17:47:30 -02:00
Alexandre Arnt
34b2dcfec6 - BugFix: simplified chinese translation. 2016-02-06 17:36:49 -02:00
Alexandre Arnt
4d89648fe5 - Added Simplified Chinese translation. 2016-02-06 17:11:33 -02:00
Alexandre Arnt
55199bce21 Merge pull request #149 from philmmanjaro/master
Add lxqt-sudo support
2016-02-06 16:41:54 -02:00
Philip
9a1ebdbca7 lxqt-sudo support
add a method to retrieve lxqt-sudo used with su backend

Signed-off-by: udeved <artoo@manjaro.org>
Signed-off-by: philm <philm@manjaro.org>
2016-01-06 09:11:52 +01:00
Alexandre Arnt
e6fdecb6e3 - New dev cycle begins... 2015-11-14 12:07:51 -02:00
Alexandre Arnt
a32aef964a - Updated CHAKRA RSS site (thanks to s8321414). 2015-11-14 12:03:42 -02:00
Alexandre Arnt
5abb0fca0f - Bumped version number in PKGBUILD. 2015-11-08 20:20:40 -02:00
Alexandre Arnt
ef6ee413b9 - Preparing for 0.8 release;
- Updated README.md.
2015-11-08 20:05:29 -02:00
Alexandre Arnt
a9be6dc995 - Updated README.md. 2015-11-08 19:40:43 -02:00
Alexandre Arnt
bfc5bb9a6b - Updated README.md. 2015-11-08 19:39:17 -02:00
Alexandre Arnt
46241ebccc - Updated README.md. 2015-11-08 19:25:29 -02:00
Alexandre Arnt
38975b4531 - Updated README.md. 2015-11-08 19:23:25 -02:00
Alexandre Arnt
80ef8f064f - README.md updated. 2015-11-08 19:18:11 -02:00
Alexandre Arnt
5de95c83d8 - Changed README to MD style. 2015-11-08 18:09:42 -02:00
Alexandre Arnt
2a944d31b9 - Changes in gitignore. 2015-11-08 18:04:53 -02:00
Alexandre Arnt
7e2cdc3f55 - Added a .gitignore file. 2015-11-08 17:50:19 -02:00
Alexandre Arnt
380fbec59e Merge branch 'master' of https://github.com/aarnt/octopi 2015-11-08 17:39:37 -02:00
Alexandre Arnt
f153e9e781 - Updated translations. 2015-11-08 17:38:54 -02:00
Alexandre Arnt
55f63bc616 - Updated translations. 2015-10-27 22:24:42 -02:00
Alexandre Arnt
28ce6706ca Merge pull request #140 from pmattern/notif-desktop
Octopi notifier: improve integration into LXQt
2015-10-20 11:39:08 -02:00
Alexandre Arnt
12ba6a089f - Fix in tab files refresh at startup. 2015-10-19 23:14:14 -02:00
Peter Mattern
ea65987f4e Octopi notifier: improve integration into LXQt
adds a key needed to make Octopi notifier work reliably in plugin-statusnotifier of LXQt
2015-10-18 21:51:36 +02:00
Alexandre Arnt
c5f56cc94f - BugFix in AUR refresh repository code. 2015-10-14 21:39:30 -03:00
Alexandre Arnt
0c74815c91 - Small code refactorings. 2015-10-14 21:25:39 -03:00
Alexandre Arnt
6cfb78a8e0 - Updated translations. 2015-10-13 22:41:46 -03:00
Alexandre Arnt
d5ba6cb44b - BugFix: Speed optimizations in startup code (AUR outdated list). 2015-10-13 00:46:54 -03:00
Alexandre Arnt
7d954d324c - Fish shell fixes. 2015-10-10 12:31:24 -03:00
Alexandre Arnt
3989f56ea0 - Trying to make Octopi fish-compatible... 2015-10-04 18:11:14 -03:00
Alexandre Arnt
5de6a1b1f6 - BugFix: "Clear" tooltip was not showing in lineedit when in plasma
desktop.
2015-10-04 11:17:52 -03:00
Alexandre Arnt
63ba41c31e - Yaourt compatibility bugfix. 2015-10-04 10:25:57 -03:00
Alexandre Arnt
4bc105c068 - BugFix: Octopi now honors the $SHELL variable (thanks to LAC1213). 2015-10-03 20:40:52 -03:00
Alexandre Arnt
21f20d0115 Merge pull request #136 from LAC1213/master
Close Issue #92
2015-10-04 09:40:31 -03:00
Alexandre Arnt
e0f818a8f7 - Removed ugly color change in URLs. 2015-10-03 15:22:12 -03:00
Alexandre Arnt
e96950a5fc - Updated translations;
- Fixes in SysInfo code.
2015-10-03 15:13:19 -03:00
Alexandre Arnt
635287d3e1 Merge pull request #137 from phoewass/bug/get-outdated-aur-packages
BugFix: getAUROutdatedPackagesNameVersion wrong behaviour with yaourt
2015-10-03 15:12:25 -03:00
Wassim
a0cbdc8ca3 BugFix: getAUROutdatedPackagesNameVersion wrong behaviour with yaourt
The issue results in AUR toolButton showing 0 packages, wrong "Outdated version" and *no* "Available version" in output tab.
"""yaourt -Qua""" yields something like this: aur/package-name 1.0.2-2 -> 1.0.3-1
2015-10-02 01:18:16 +02:00
Wassim
af0004de87 Merge pull request #1 from aarnt/master
Sync with aarnt/octopi
2015-10-02 01:04:10 +02:00
LAC1213
d7d754775f remove swap files 2015-09-27 01:25:27 +02:00
LAC1213
ad2246d440 look up $SHELL environment variable instead of using bash when running commands in terminal 2015-09-27 01:20:26 +02:00
Alexandre Arnt
44d2c5c6f7 - Removed QT_VERSION swtich code from searchlineedit;
- Reverted code change in doInstall() for running inside terminals.
2015-09-26 18:27:03 -03:00
Alexandre Arnt
76a97eaa32 Merge pull request #133 from LAC1213/master
use sudo when running command in terminal
2015-09-26 18:08:45 -03:00
Alexandre Arnt
33190350e1 - BugFix: Added option to search files with "\+" (escaping the plus
sign). This would find things such    as C++ => "c\+\+" (thanks to
maxis11).
2015-09-26 18:00:36 -03:00
Alexandre Arnt
1212ad3ac9 - Obfuscation in <HOSTNAME> and <HOME_PATH> outputs of SysInfo;
- Updated translations.
2015-09-26 17:49:08 -03:00
Alexandre Arnt
29e7f4bb70 - Updated translations. 2015-09-20 16:46:28 -03:00
Alexandre Arnt
3b196a5253 Merge branch 'master' of https://github.com/aarnt/octopi 2015-09-17 22:21:31 -03:00
Alexandre Arnt
109b7f1ad7 - Updated translation. 2015-09-17 22:20:56 -03:00
LAC1213
1059921827 use sudo when running command in terminal 2015-09-17 20:34:34 +02:00
Alexandre Arnt
02a4df3729 - BugFix: Outdated AUR pkgs were not showing outdated versions
correctly, when using "yaourt" tool.
2015-09-13 18:31:59 -03:00
Alexandre Arnt
1920d511f1 - Updated translations. 2015-09-13 12:14:20 -03:00
Alexandre Arnt
54beab98db - Updated translation. 2015-09-07 18:42:21 -03:00
Alexandre Arnt
e811845fd7 - Updated translations. 2015-09-07 18:17:12 -03:00
Alexandre Arnt
fa6e945e67 - Updated translations. 2015-09-07 18:10:35 -03:00
Alexandre Arnt
3ae05a4518 - Updated translations. 2015-09-07 17:48:15 -03:00
Alexandre Arnt
aa623c94ad - Updated translations;
- Added 'kcp --information' to a separate thread.
2015-09-07 16:04:30 -03:00
Alexandre Arnt
8168a0ed56 - Updated translations. 2015-09-07 12:39:17 -03:00
Alexandre Arnt
32a5287a98 - Updated 8 translations! 2015-09-07 09:44:28 -03:00
Alexandre Arnt
8e6409e7f2 - Removed debug code from class Package. 2015-09-06 18:43:27 -03:00
Alexandre Arnt
32286dc736 - Added support to "kcp --information" at Info tab. 2015-09-05 19:34:55 -03:00
Alexandre Arnt
59b945ea4c - Updated translations. 2015-09-05 16:48:57 -03:00
Alexandre Arnt
fb4755d10f - Now tab Files shows a progressbar while building the list of files. 2015-08-15 18:02:45 -03:00
Alexandre Arnt
a0ec3a2b2c - Upgraded translation;
- BugFix: A wrong index number was taken when parsing the output of
yaourt -Qua (thanks to jdelmas).
2015-08-15 17:42:56 -03:00
Alexandre Arnt
f9fb3b86aa - Added green font color to mirror check output (synced repos). 2015-08-09 17:12:51 -03:00
Alexandre Arnt
05bb8acb6c Merge branch 'master' of https://github.com/aarnt/octopi 2015-08-09 16:51:37 -03:00
Alexandre Arnt
0cb937d6b3 - BugFix: No columns warning while executing actions inside Octopi
(thanks to flying-sheep).
2015-08-09 16:51:15 -03:00
Alexandre Arnt
08c392a4c1 Merge pull request #126 from jdelmas/master
BugFix: In Cinnamon, gnome-terminal wasn't handled properly causing Xterm to be used as a fallback.
2015-08-09 12:29:50 -03:00
Jean Delmas
0eb06cebd6 BugFix: In Cinnamon, gnome-terminal wasn't handled properly causing Xterm to be used as a fallback. 2015-08-09 16:49:51 +02:00
Alexandre Arnt
b486e9a091 - Updated translations. 2015-08-09 11:11:13 -03:00
Alexandre Arnt
2ee166c9b7 - BugFix: Transaction dialog can now be resized and new value is
persisted on disk;
- Updated translations.
2015-08-01 09:26:24 -03:00
Alexandre Arnt
3906d74396 - BugFix: TransactionDialog can now be resized;
- Yellow notifier icon tooltip now displays Foreign repo tool name;
- Updated translations.
2015-07-22 21:54:11 -03:00
Alexandre Arnt
67a6603c4c Merge pull request #123 from flying-sheep/patch-1
Don’t constrain dialog size needlessly
2015-07-21 12:57:36 -03:00
Philipp A.
54c8eb676b Don’t constrain dialog size needlessly 2015-07-21 17:45:44 +02:00
Alexandre Arnt
6df0f8a03d - BugFix: If user refused to remove pacman's lock file, commands should
be canceled!
2015-07-12 18:32:44 -03:00
Alexandre Arnt
78640ff72f - Updated translations. 2015-07-12 17:30:42 -03:00
Alexandre Arnt
b8e662c7d2 - Updated CHANGELOG file. 2015-07-12 16:56:55 -03:00
Alexandre Arnt
7954e39ad9 - Removed Qt4 compatibility from cachecleaner and repoeditor
subprojects.
2015-07-12 16:23:49 -03:00
Alexandre Arnt
ea5caa0ea3 - Updated translations. 2015-07-12 16:16:51 -03:00
Alexandre Arnt
0e215b619b - Added Parabola GNU/Linux-libre support (thanks to coadde). 2015-07-11 18:13:51 -03:00
Alexandre Arnt
fb0320a395 - Updated some translations. 2015-07-09 22:52:27 -03:00
Alexandre Arnt
236fafa8b2 - Added galician translation (thanks to Ismael Ordóñez) and updated
others.
2015-07-09 22:19:58 -03:00
Alexandre Arnt
f0d95aeabe - Fixed Copyright issue with Pacman help/about string. 2015-07-05 16:10:22 -03:00
Alexandre Arnt
d9848f6b13 - BugFix: When user closed searchbar inside a QTextBrowser, cursor
position was reseted.
2015-07-05 13:48:00 -03:00
Alexandre Arnt
8b6455b92f - Updated translations. 2015-07-04 20:00:45 -03:00
Alexandre Arnt
61e4c631be - When outdated packages are printed at Output tab, you can see their
information just hovering the mouse over them;
- At Info tab, packages in "depends On" field are shown as clickable
anchors;
- Information tab now supports "ctrl+F" searching;
- Help/About dialog now shows Pacman information.
2015-07-04 19:53:16 -03:00
Alexandre Arnt
9c66c2c0f4 - BugFix for compilation in Qt 5.5 systems. 2015-06-27 17:42:35 -03:00
Alexandre Arnt
6a51980b4c - BugFix: If user tried to sync db with kdesu and clicked "ESC", some
garbage went to Output tab.
2015-06-27 12:27:17 -03:00
Alexandre Arnt
5d38bb56ad - BugFix: In some very specific situations Info tab did not refresh info
of selected package;
- StatusBar msg got updated with number of selected packages more
visible;
- Updated pt_BR translation.
2015-06-27 10:53:58 -03:00
Alexandre Arnt
ab6ed11e56 - Updated translations and initialization code fix (thanks to offa). 2015-06-10 17:31:40 -03:00
Alexandre Arnt
cd8837cef3 Merge pull request #114 from offa/code_tweak
Code tweak
2015-06-10 17:21:25 -03:00
offa
169ea13eba Memberinitialisation changed to init-list. 2015-06-10 11:52:16 +02:00
Alexandre Arnt
68a96a7118 - BugFix: Package counters were not zeroing when searches found no
results.
2015-06-09 11:03:15 -03:00
Alexandre Arnt
737cc611c6 - Fixes in remove method call. 2015-06-07 20:29:48 -03:00
Alexandre Arnt
bffb34a7d8 - Added bugfix code from "phoewass";
- Updated some translations.
2015-06-03 21:25:29 -03:00
Alexandre Arnt
874b4ca57a Merge pull request #113 from phoewass/patch-1
BugFix: Crash when UnixCommand::getPackageList doesn't yield results
2015-06-03 21:00:35 -03:00
Wassim
b0db738663 BugFix: Crash when UnixCommand::getPackageList doesn't yield results
This bug happens when UnixCommand::getPackageList retruns
an empty QString after running pacman command.
2015-05-28 02:02:56 +02:00
Alexandre Arnt
b9d40becde - Updated portuguese translations. 2015-05-16 17:47:19 -03:00
Alexandre Arnt
e01f58d7ee - BugFix: Sync Interval dialog was not showing strings in some
languages.
2015-05-12 20:50:49 -03:00
Alexandre Arnt
43b75264f5 BugFix: Qt4 translation issues at menubar. 2015-04-27 20:05:43 -03:00
Alexandre Arnt
f17ee4f211 - Fix an Octopi compile bug with Qt4 libs. 2015-04-25 19:21:46 -03:00
Alexandre Arnt
9b85932c0e - Added space chars to filter line edit widget. 2015-04-25 18:06:40 -03:00
Alexandre Arnt
acdd152437 - Trying to get a translated SU dialog... 2015-04-25 17:17:15 -03:00
Alexandre Arnt
ecd6701de0 - Release prep... 2015-04-25 16:33:37 -03:00
Alexandre Arnt
f5edc8bf69 - Some changes in notifier (-d switch);
- Updated asturian translation.
2015-04-25 10:42:21 -03:00
Alexandre Arnt
4bc88b8502 - Added a "-d" switch to octopi to show some debug info (speed related). 2015-04-18 02:41:24 -03:00
Alexandre Arnt
3eb3836f94 - Size fix in head command. 2015-04-18 02:20:34 -03:00
Alexandre Arnt
d61ecd533d - Fixed refreshTools method. 2015-04-18 01:49:27 -03:00
Alexandre Arnt
9e27bcb1de - Tools menu refresh code. 2015-04-18 01:39:33 -03:00
Alexandre Arnt
045c17b5e2 - Restrict pacman.log output to the first 256K while not in KaOS. 2015-04-18 00:47:13 -03:00
Alexandre Arnt
b7f1931ce3 - Removed some color codes from pacaur output. 2015-04-18 11:32:02 -03:00
Alexandre Arnt
1a288a3461 - Updated turkish translation. 2015-04-17 20:36:23 -03:00
Alexandre Arnt
82cffd10ab - Now Package treeview columns get their widths saved. 2015-04-10 09:09:08 -03:00
Alexandre Arnt
42f9042c0c - BugFix: Use user language in SU dialog while in CacheCleaner. 2015-04-09 23:17:40 -03:00
Alexandre Arnt
4ce02a273a - Removed another annoying string in parser;
- Present SU dialog in user's language when Ctrl+Shif+C.
2015-04-09 22:53:39 -03:00
Alexandre Arnt
71a3244ff6 - Updated translations. 2015-04-08 21:47:30 -03:00
Alexandre Arnt
8d2ac9ab47 - Reenabled Pacaur support. 2015-04-08 21:45:25 -03:00
Alexandre Arnt
2a6e5c639f - BUGFIX: description of foreign pkgs were not being shown in dependency
pkgs removal dialog (thanks to FadeMind);
- Updated translations.
2015-04-06 20:06:40 -03:00
Alexandre Arnt
6f82d23d5c - Updated hebrew translation. 2015-03-31 22:29:10 -03:00
Alexandre Arnt
8829e2cf74 - Updated translations. 2015-03-24 21:03:26 -03:00
Alexandre Arnt
454be62345 - Added 'gist' in optdeps. 2015-03-24 17:31:14 -03:00
Alexandre Arnt
ea99a38f65 Merge pull request #90 from offa/some_codeimprovements
Thanks!
2015-03-24 17:23:19 -03:00
Alexandre Arnt
fecca49bfd - Added "pacman -Qm" to SysInfo. 2015-03-24 17:21:19 -03:00
offa
dcaf8dffba Missing inits added to ctor's. 2015-03-24 20:46:57 +01:00
offa
7c1a16f9e1 More efficient iterator increment. 2015-03-24 20:35:15 +01:00
offa
16fbcb820c The value of n is always != 1 if it's > 1380. 2015-03-24 20:26:54 +01:00
Alexandre Arnt
297129490a - Changed SysInfo commands. 2015-03-24 13:34:54 -03:00
Alexandre Arnt
8ea872b5de - Had to remove ampersand texts manually as Qt Designer insists on
putting them in menus and action texts.
2015-03-24 13:26:35 -03:00
Alexandre Arnt
0cce7fbe50 - Added "uname -a" to SysInfo;
- Made SysInfo available in all distros.
2015-03-24 12:41:20 -03:00
Alexandre Arnt
dec80408b0 - Added "/etc/KaOS-release" to SysInfo. 2015-03-24 11:04:28 -03:00
Alexandre Arnt
39a10b79c1 - Added SysInfo to Tools menu;
- Updated translation.
2015-03-24 10:22:52 -03:00
Alexandre Arnt
8550919a11 - Generate a system info report if "gist" is available in KaOS;
- Updated translation.
2015-03-23 22:10:02 -03:00
Alexandre Arnt
011b335bc7 - Gets the pkg file list from another thread. 2015-03-23 17:48:25 -03:00
Alexandre Arnt
00f4cab3c2 - Updated translations. 2015-03-23 13:26:25 -03:00
Alexandre Arnt
de9636e78b - Updated CHANGELOG. 2015-03-22 16:11:34 -03:00
Alexandre Arnt
c0f70009ab - BugFix: Sometimes downloaded and installed size information were in
KiB, instead of MiB;
- Updated translations.
2015-03-22 15:42:41 -03:00
Alexandre Arnt
343f70f899 BugFix: description tooltips of foreign pkgs were not showing. 2015-03-22 14:04:09 -03:00
Alexandre Arnt
7c46f29e53 - Updated german translation. 2015-03-22 13:41:56 -03:00
Alexandre Arnt
ecabd0ef99 - Updated german translation (thanks to Gyges). 2015-03-22 12:57:26 -03:00
Alexandre Arnt
dee0487534 - BugFix: Changes in the getFieldFromPacmanConf code. 2015-03-22 10:47:05 -03:00
Alexandre Arnt
d866675bde - BugFix: SetupDialog selection code and UI. 2015-03-20 21:49:23 -03:00
Alexandre Arnt
027cb325b4 Merge branch 'master' of https://github.com/aarnt/octopi 2015-03-21 10:49:21 -03:00
Alexandre Arnt
fff446709a - Updated translations. 2015-03-21 10:48:58 -03:00
Alexandre Arnt
1e98aa8bf4 - Updated translation;
- Fix in buggy string that could pop into sync db.
2015-03-20 15:38:27 -03:00
A
5e7853eb35 - BugFix: toggle setInterval action as well. 2015-03-13 22:27:29 -03:00
A
d1a443526c - Added SetupDialog layout managers. 2015-03-13 22:01:35 -03:00
Alexandre Arnt
457c317139 - It's better to default to a Qt4 build for notifier in case of non KDE
systems;
2015-03-13 03:27:24 -03:00
Alexandre Arnt
28d5e29388 - Updated translations. 2015-03-13 03:11:01 -03:00
Alexandre Arnt
0c97a21a45 - Minimum minutes interval is 5;
- Updated translations.
2015-03-19 22:12:08 -03:00
Alexandre Arnt
2cc070a4e1 - Updated translations. 2015-03-19 21:40:28 -03:00
Alexandre Arnt
e699035f62 - Another string in SetupDialog. 2015-03-19 21:29:12 -03:00
Alexandre Arnt
7fba0a27fa - Updated translations. 2015-03-19 21:17:32 -03:00
Alexandre Arnt
9cbd325a71 - More strings to notifier setup dialog. 2015-03-19 21:05:16 -03:00
Alexandre Arnt
cd7450e6f6 - Add a notifier setup dialog to set "sync database" interval. 2015-03-19 20:41:14 -03:00
Alexandre Arnt
be4d2dcbb4 - Updated translation. 2015-03-18 17:51:46 -03:00
Alexandre Arnt
724b84f19e Updated translations 2015-03-18 13:33:42 -03:00
Alexandre Arnt
73b684d231 - BugFix: removed some annoying fontconfig warning. 2015-03-17 22:51:38 -03:00
Alexandre Arnt
45427b66e6 - Reverted an UI buggy change. 2015-03-17 15:51:07 -03:00
Alexandre Arnt
809ab326c0 - BugFix: AUR list was not honoring View menu changes. 2015-03-17 12:42:28 -03:00
Alexandre Arnt
81442491e3 - mirrorCheck() was commented :-) 2015-03-16 23:17:18 -03:00
Alexandre Arnt
84feaa08ac - BugFix: No more horizontal scrollbar in AUR mode. 2015-03-16 23:14:13 -03:00
Alexandre Arnt
27e33704f1 - Updated bulgarian translation. 2015-03-16 21:28:15 -03:00
Alexandre Arnt
66cf5dad0b - BugFix: compilation error in notifier (thanks to UndeadKernel and
FadeMind).
2015-03-16 21:25:38 -03:00
Alexandre Arnt
ff206fa18f - Some refactorings;
- BugFix: AUR outdated icon must honor IgnorePkg.
2015-03-16 18:47:53 -03:00
Alexandre Arnt
8781b20696 fix in toggle buttons code 2015-03-16 11:47:05 -03:00
Alexandre Arnt
6e64544c25 - BugFix: When a transaction is available, disable sync pkg and system
upgrade, as well as mirror-check and AUR mode;
- BugFix: Repository column would get wider after switching from AUR
mode.
2015-03-13 00:57:02 -03:00
Alexandre Arnt
a1a3d62813 - All qt5 dependencies can be brought up by that one: qt5-quickcontrols. 2015-03-12 22:18:20 -03:00
Alexandre Arnt
769835484e - SearchBar now reacts to an ENTER or RETURN key press to search for
next found item.
2015-03-12 21:51:31 -03:00
A
a0a554d76e - It's better to disable repoeditor while in a pacman "transaction". 2015-03-13 18:41:14 -03:00
Alexandre Arnt
79445660ba - Disable cachecleaner in menu while in a pacman transaction,
- Updated german translation.
2015-03-13 15:58:02 -03:00
Alexandre Arnt
9fee78dcc2 - Tries to refresh events when we are updating pkg list after a pacman
command that changed it;
- Some refactorings;
- Updated translations.
2015-03-13 14:43:59 -03:00
Alexandre Arnt
2f0db01266 - Updated romanian translation. 2015-03-12 21:38:36 -03:00
Alexandre Arnt
96b475a6ac - Added Systemd's "octopi.service" to speed up the very first Octopi
startup time.
2015-03-12 21:16:39 -03:00
A
b29acff5f9 - Had to serialize first two QFuture calls to avoid a segfault due to a
null pointer read.
2015-03-12 18:39:41 -03:00
Alexandre Arnt
029aa42073 - Another time mesurement. 2015-03-11 22:04:01 -03:00
A
a604cd5fff - Trying to hunt down a segfault at startup. 2015-03-11 23:02:41 -03:00
Alexandre Arnt
72788fc7df - parenthesis for clarity... 2015-03-12 14:59:21 -03:00
Alexandre Arnt
9c16ff387d - BugFix: outdated foreign packages were not being marked in the main
list;
- Some refactorings.
2015-03-12 14:42:39 -03:00
Alexandre Arnt
5421bf328c - Reverting a small change... 2015-03-11 21:15:16 -03:00
Alexandre Arnt
030d646673 - BugFix: If user had no gksu/kdesu/root when clicking "clean" button in
cachecleaner, cursor would remain waiting (thanks to imperator-);
- More time measurements.
2015-03-11 21:08:21 -03:00
Alexandre Arnt
05221396cf - BugFix: F3 and Shift+F3 keys at SearchBar were not working;
- Removed the eventfilter.
2015-03-11 18:06:15 -03:00
Alexandre Arnt
b47678f14b - Using some QFutures to speed up startup time;
- Updated translations;
- Some naming refactorings.
2015-03-11 16:50:20 -03:00
A
14d9f45dff - Disabled "View/Repository/kcp" menu item in KaOS. 2015-03-10 21:40:38 -03:00
Alexandre Arnt
c1a0e57aed - Updated translations. 2015-03-10 20:14:18 -03:00
Alexandre Arnt
2a78942c0b - new resource icon. 2015-03-10 18:18:57 -03:00
Alexandre Arnt
a1c6a7a183 - Added "Copy path to clipboard" context menu option in file list
treeview;
- Toolbar now shows AUR tool button instead of a fake pacman group;
- BugFix: Search by name was not being used after reverting from AUR
search.
2015-03-10 18:16:29 -03:00
Alexandre Arnt
b7d127e479 - Toolbar now shows AUR tool button instead of a fake pacman group;
- BugFix: Search by name was not being used after reverting from AUR
search.
2015-03-10 16:23:01 -03:00
Alexandre Arnt
f5c2acd391 - Bunch of refactorings;
- Updated italian translation.
2015-03-10 10:20:54 -03:00
Alexandre Arnt
eb07995085 - Count miliseconds in pkg list building. 2015-03-10 09:45:15 -03:00
Alexandre Arnt
42f0feee7b - Trying to get rid of buildPackageList(false) calls. 2015-03-10 09:30:33 -03:00
Alexandre Arnt
8199bdeb42 - Remove "Yes" button from transaction dialog, everytime 'pacman' is one
of the target packages.
2015-03-09 14:56:24 -03:00
Alexandre Arnt
5fcb1bd7c4 - Now pacman.conf's "IgnoreGroup" option is honored;
- Some refactorings.
2015-03-08 19:20:36 -03:00
Alexandre Arnt
cce3c0b331 - Progressbar again shows pkg list creation. 2015-03-08 17:41:15 -03:00
Alexandre Arnt
c7ee993741 - BugFix: Filter connect chain bug decreased filter's performance over
time.
2015-03-08 16:18:58 -03:00
Alexandre Arnt
69d4d558c0 - Updated translations. 2015-03-08 12:01:38 -03:00
Alexandre Arnt
54f31695ab - Begin of 0.6.1 dev cycle;
- Major speed fix: Faster pkg list building;
- Reverted to showing ALL packages at startup.
2015-03-08 11:28:13 -03:00
Alexandre Arnt
c79a0c9d9f - Updated Manjaro RSS site (thanks to FadeMind);
- Updated bulgarian translation (thanks to loot270).
2015-02-27 11:56:34 -03:00
Alexandre Arnt
94d4adff7f - Bumped release to 0.6.0 as this has more than bugfixes. 2015-02-26 10:40:30 -03:00
Alexandre Arnt
b07263afa3 - BugFix: Removed another buggy string while in plasma5.
- Call kcp -u in notifier too.
2015-02-25 16:43:21 -03:00
Alexandre Arnt
9659159206 - Updated hungarian translation. 2015-02-23 22:45:46 -03:00
Alexandre Arnt
15210b81ba Merge branch 'master' of https://github.com/aarnt/octopi 2015-02-23 21:39:42 -03:00
Alexandre Arnt
80cb907702 - Removed more output strings for the parser. 2015-02-23 21:38:53 -03:00
Alexandre Arnt
3133912c8a - More info at notifier errors. 2015-02-22 19:26:56 -03:00
Alexandre Arnt
685638724d - BugFix: Opens install local pkg when you associate octopi to pacman
files (thanks to ringo32 for error report).
2015-02-22 19:02:26 -03:00
Alexandre Arnt
34081c8b70 - Now notifier does not close Octopi;
- Notifier clock tick is 5 minutes now.
2015-02-22 12:02:54 -03:00
Alexandre Arnt
5325a02337 - BugFix: Let's not forget to reenable transaction buttons :-) 2015-02-22 11:28:23 -03:00
Alexandre Arnt
4d27652cb6 - BugFix: Order of methods. 2015-02-22 11:19:22 -03:00
Alexandre Arnt
ee00aaa21b - Always reset to "View ALL/ALL repos" when pkg group is changed. 2015-02-22 10:56:26 -03:00
Alexandre Arnt
b42a48095d - Updated asturian translation;
- Keep "sync repos" button enabled while in KCP mode.
2015-02-22 10:25:46 -03:00
Alexandre Arnt
5d272a72b2 - Updated indonesian translation. 2015-02-21 14:41:41 -02:00
Alexandre Arnt
681e844dc7 - Updated translation. 2015-02-20 20:24:43 -02:00
Alexandre Arnt
9bccb030e9 - BugFix: Pkg list was being refreshed twice sometimes. 2015-02-18 22:24:41 -02:00
Alexandre Arnt
95c07a7b25 - Updated translations. 2015-02-18 12:44:38 -02:00
Alexandre Arnt
cc1f174443 - Updated translations. 2015-02-17 21:37:39 -02:00
Alexandre Arnt
69eed61396 - New method: refreshPackageList, to help bring pkgs groups to life in
some conditions.
2015-02-17 19:53:11 -02:00
Alexandre Arnt
993c099624 - Refactored logic of show only installed pkgs at startup. This fixes
the error of package group refresh!
2015-02-17 19:33:27 -02:00
Alexandre Arnt
b83bf040f6 - Switched PackageListItems to ViewOptions. 2015-02-17 16:01:41 -02:00
Alexandre Arnt
3ce0991973 - Changed behavior in pkg group selection;
- Updated some translations.
2015-02-17 14:37:34 -02:00
Alexandre Arnt
6197e3faec - Updated turkish translation. 2015-02-16 21:22:33 -02:00
Alexandre Arnt
3820b51c34 - Fixed View All pkgs logic. 2015-02-16 17:12:29 -02:00
Alexandre Arnt
31363daccd - Updated translations. 2015-02-16 16:25:10 -02:00
Alexandre Arnt
1cc419150a - Updated translations. 2015-02-16 16:23:37 -02:00
Alexandre Arnt
2a61702569 - Updated translations. 2015-02-16 16:21:55 -02:00
Alexandre Arnt
be0178a94e - Added more safety checks before running octopi-notifier. 2015-02-16 15:43:38 -02:00
Alexandre Arnt
0050d3d8de - Disabled Pacaur support;
- When entering AUR group, switch to View all pkgs.
2015-02-16 12:06:23 -02:00
Alexandre Arnt
2f9ef42357 - BugFix: PacmanHelper is a project related to Octopi-notifier (fix at
PKGBUILD).
2015-02-16 11:44:54 -02:00
Alexandre Arnt
74f879cb88 - BugFix: View all pkgs logic. 2015-02-16 11:08:10 -02:00
Alexandre Arnt
a146d168a1 - Updated translations. 2015-02-15 21:23:14 -02:00
Alexandre Arnt
fc199b5e95 - Updated cachecleaner japanese translation. 2015-02-15 11:29:12 -02:00
Alexandre Arnt
f59aebab71 - BugFix: Sometimes a "failed" repo name could appear while synching
dbs.
2015-02-14 22:08:11 -02:00
Alexandre Arnt
8dfba85d39 - BugFix: ArrowUp/Down, PageUp/Down and Home/End keys now refresh
Package Info tab;
- At startup only installed packages are shown (if distro is not KaOS);
- Updated translations.
2015-02-14 20:22:23 -02:00
Alexandre Arnt
fb1bff9c62 - Updated translations. 2015-02-07 09:29:45 -02:00
Alexandre Arnt
c446a21d35 - BugFix: CacheCleaner translation support. 2015-02-04 23:18:47 -02:00
Alexandre Arnt
24b80cad41 - Fixed cachecleaner icon (thanks to demm). 2015-02-04 22:26:50 -02:00
Alexandre Arnt
1e61af57f7 - React to "==> Candidate packages: *.pkg.tar?(.+([^.]))" output from
paccache.
2015-02-04 20:53:11 -02:00
Alexandre Arnt
55974a0843 BugFix: missing icons... 2015-02-04 08:55:38 -02:00
Alexandre Arnt
4d2477f2ca - Changed some tool icons. 2015-02-03 22:00:25 -02:00
Alexandre Arnt
d9be6c0357 - Added cachecleaner, a frontend to 'paccache' (thanks to Michaël
Lhomme).
2015-02-03 20:24:05 -02:00
Alexandre Arnt
b87f961574 - Added cachecleaner, a frontend to 'paccache' (thanks to Michaël
Lhomme).
2015-02-02 18:38:55 -02:00
Alexandre Arnt
b6081c5891 - Added cachecleaner, a frontend to 'paccache' (thanks to Michaël
Lhomme).
2015-02-02 18:35:57 -02:00
Alexandre Arnt
a7fb48912b Merge pull request #74 from papylhomme/cachecleaner
Cachecleaner
2015-02-02 11:06:36 -02:00
Michaël Lhomme
e7896a08dd Setup localization for CacheCleaner based on current Octopi translations 2015-01-31 15:44:01 +00:00
Michaël Lhomme
9f058e838b Refactoring to avoid code duplication 2015-01-31 15:41:19 +00:00
Michaël Lhomme
aacdefe1dc Fix label in UI 2015-01-31 14:35:09 +00:00
Michaël Lhomme
654d8b07c2 Restore CacheCleaner menu item in Octopi 2015-01-31 13:03:28 +00:00
Michaël Lhomme
934d7971cc Install CacheCleaner as part of Octopi package 2015-01-31 12:01:45 +00:00
Michaël Lhomme
551fd171b6 Add a .desktop fie to start CacheCleaner 2015-01-31 10:50:40 +00:00
Michaël Lhomme
6da7d70492 Reverting change to Octopi's MainWindow menu items 2015-01-31 10:42:06 +00:00
Michaël Lhomme
c27a10a5f7 New component to accumulate UnixCommand outputs 2015-01-30 20:16:01 +00:00
Michaël Lhomme
204ed315ae Revert "Fix bug in UnixCommand"
This reverts commit 3e7d9ac9da, breaks
octopi usage
2015-01-30 18:53:23 +00:00
Michaël Lhomme
8b4c859c04 Add new tool CacheCleaner, frontend to paccache 2015-01-30 16:58:23 +00:00
Michaël Lhomme
3e7d9ac9da Fix bug in UnixCommand
'm_readAllStandardOutput' and 'm_readAllStandardError' are overwritten
each time new content is available, ultimately leading to empty strings
once the process finish
2015-01-30 14:03:02 +00:00
A
2afd78c3eb - Updated translations in Octopi and RepoEditor. 2015-01-29 22:08:49 -02:00
Alexandre Arnt
900e167f89 - A small comment fix and refresh :-) 2015-01-27 21:03:37 -02:00
Alexandre Arnt
451d572441 - Added spanish (AR and ES) translation to repoeditor (thanks to
dagodax);
- Updated some translations.
2015-01-27 19:58:42 -02:00
Alexandre Arnt
22157d2a4b - Added octopi-repoeditor norwegian translation (thanks to viking60);
- Updated octopi norwegian translation (thanks to viking60).
2015-01-26 22:13:23 -02:00
Alexandre Arnt
d22b24e9bf - Remove cyan color code from kcp result. 2015-01-26 20:25:25 -02:00
Alexandre Arnt
66153991a7 Merge pull request #72 from philmmanjaro/patch-1
Update PKGBUILD
2015-01-26 20:19:47 -02:00
Philip Müller
c9c6ab6bb9 Update PKGBUILD
- make octopi a opt-dep for notifier
- this refects changes made within 47c681b4ab
2015-01-26 13:45:50 +01:00
Alexandre Arnt
a4c155f3e1 Merge pull request #69 from prescott66/patch-2
Fix slovak translation of octopi.desktop comment
2015-01-22 10:30:37 -02:00
Alexandre Arnt
cadb394ef8 Merge pull request #70 from prescott66/patch-3
Fix master version number for created packages
2015-01-22 10:30:28 -02:00
Dušan Kazik
5a3ed18bfe Fix master version number for created packages 2015-01-22 11:32:14 +01:00
Dušan Kazik
8c513594a2 Fix slovak translation of octopi.desktop comment 2015-01-22 11:27:23 +01:00
Alexandre Arnt
47c681b4ab - BugFix: When only notifier is installed, we don't refer Octopi in
context menu nor system upgrade dialog;
- Updated translations.
2015-01-21 21:23:31 -02:00
Alexandre Arnt
6eb3ece341 - Updated 2 translations;
- Refactored a bunch of MainWindow methods.
2015-01-18 14:37:02 -02:00
Philip
9077dcb6a3 Buildfix 2015-01-18 14:58:01 +01:00
A
3f1bd82dd5 - Updated 3 translations. 2015-01-18 10:48:56 -02:00
Alexandre Arnt
8a8a838686 - Updated translations. 2015-01-17 21:29:29 -02:00
Alexandre Arnt
6fbf9090d6 - Updated notifier string calls;
- Pulled all updated translations.
2015-01-17 21:11:21 -02:00
Alexandre Arnt
2cf30cab35 - BugFix: Honor plural forms in some languages (thanks to SafaAlfulaij);
- Refactorings in some StrConstants methods.
2015-01-17 20:40:06 -02:00
Alexandre Arnt
a20572c35f - Added 2 new translations to repoeditor. 2015-01-17 18:37:51 -02:00
Alexandre Arnt
b398e7e20c - BugFix: Repoeditor uses user defined translation (if available) while
launched from Octopi;
- Now PKGBUILD defaults to Qt5 builds.
2015-01-17 18:32:33 -02:00
Alexandre Arnt
50d0a57060 Merge pull request #66 from prescott66/patch-1
Fix build
2015-01-17 17:35:05 -02:00
Dušan Kazik
8bddb0b68e Fix build 2015-01-17 17:49:04 +01:00
Alexandre Arnt
40f4f1afcd - BugFix: Notifier wouldn't test for internet connection; 2015-01-17 11:29:56 -02:00
Alexandre Arnt
50358b224a - New translations to repoeditor;
- Pacaur support restored!
2015-01-17 11:13:06 -02:00
A
009af59774 - Added repoeditor french translation (thanks to Loubrix). 2015-01-17 00:02:44 -02:00
A
bd6d8a02f4 - Some changes/bugfixes in Repoeditor code. 2015-01-16 23:54:13 -02:00
A
022ef7df7a - Added Repoeditor translation files to Transifex;
- Added Repoeditor slovak translation (thanks to prescott66).
2015-01-16 21:41:07 -02:00
A
db0f5ac7ab - Logic bugfixes;
- String fixes;
- Refactor: Rollback transaction is now Cancel transaction.
2015-01-13 23:23:36 -02:00
A
f0f498a632 - Fixed a typo in a member variable. 2015-01-11 20:19:12 -02:00
Alexandre Arnt
76c4d8654d - Updated slovak translation. 2015-01-11 10:13:21 -02:00
Alexandre Arnt
d61708f8c2 - AUR support bug fixes. 2015-01-04 13:09:07 -02:00
Alexandre Arnt
4e28231cc2 - KaOS only: better KCP integration. 2015-01-03 17:05:02 -02:00
Alexandre Arnt
89de7133d1 - KaOS only: modifications in AUR code, to deal with newer KCP version. 2015-01-03 15:07:48 -02:00
Alexandre Arnt
f6083977a5 - BugFix: newer kcp version was not working. 2014-12-25 16:45:23 -02:00
Alexandre Arnt
29bbe61af8 - Cleaned some QTGZManager residual code... 2014-12-22 23:25:37 -02:00
Alexandre Arnt
e3fb6bc887 - Updated translation;
- Cleaned unused code;
- Added support for 'sakura' terminal.
2014-12-20 22:45:28 -02:00
Alexandre Arnt
6f1f067710 - Updated translations. 2014-12-14 12:00:50 -02:00
Alexandre Arnt
9ced5cf29d - BugFix: Removed some buggy strings from Output tab while in KF5;
- BugFix: Open file was not working in KF5;
- BugFix: Filter by repo was not working with Qt 5.4 libs (thanks to
sl1pkn07).
2014-12-13 23:40:36 -02:00
Alexandre Arnt
c48eca9d64 - Added a FileSystemWatcher connect in the constructor too;
- Updated translations.
2014-11-29 09:31:24 -02:00
Alexandre Arnt
aad9f7dd5b Merge branch 'master' of https://github.com/aarnt/octopi 2014-11-23 20:30:55 -02:00
Alexandre Arnt
ab56f69f9e - tx config. 2014-11-23 20:30:26 -02:00
Alexandre Arnt
3fb1762bf6 - A bit of refactorings in notifier code order;
- Asturian translation update.
2014-11-23 20:28:31 -02:00
Alexandre Arnt
ff4bbb989e - Added ".tx" path to GitHub. 2014-11-20 09:23:43 -02:00
Alexandre Arnt
c5538c4651 - Removed "|" char among package counters. 2014-11-19 23:02:10 -02:00
Alexandre Arnt
2ab0610e64 - Some Refactorings. 2014-11-19 21:43:55 -02:00
Alexandre Arnt
9a2bc2342c - Updated TRANSLATIONS file;
- Updated arabic translation.
2014-11-18 23:51:21 -02:00
Alexandre Arnt
cd5eb59aab - BugFix: Chakra CCR for installing pkgs was not being called. 2014-11-17 20:56:35 -02:00
Alexandre Arnt
6e7caeb794 - Added new KDE detection logic (thanks to Kirek);
- Refactorings in SearchLineEdit.
2014-11-15 16:50:14 -02:00
Alexandre Arnt
5e007283bd Merge pull request #54 from Kirek/master
Fix detection of a running KDE desktop
2014-11-15 16:38:52 -02:00
Ramon Buldó
c04eea37f3 Fix detection of a running KDE desktop
-In newer version of kwin the binary is named kwin_x11 or kwin_wayland
2014-11-11 16:17:30 +01:00
Alexandre Arnt
8b62b30606 - Small bugfixes;
- Updated translation.
2014-11-08 11:16:32 -02:00
Alexandre Arnt
c19df7fe10 Merge pull request #53 from Kirek/master
Fix default title in plasma5 system tray
2014-11-08 11:05:10 -02:00
Ramon Buldó
e017793605 Fix default title in system tray for plasma5 2014-11-08 08:35:25 +01:00
Alexandre Arnt
bf375e96f4 Merge pull request #52 from Kirek/master
Fix GenericName/Name in octopi.desktop
2014-11-07 13:24:51 -02:00
Ramon Buldó
e109ffa4da Fix GenericName/Name in octopi.desktop 2014-11-07 15:36:50 +01:00
Alexandre Arnt
c3d495d876 - BugFix: c++11 was not working with Qt4 builds. 2014-11-04 23:25:09 -02:00
Alexandre Arnt
59b93f784f - Updated CHANGELOG. 2014-11-04 21:31:19 -02:00
Alexandre Arnt
51fe6675a3 - Added Qt version in About dialog boxes (also in notifier);
- Added some debug info in notifier.
2014-11-03 22:27:09 -02:00
Alexandre Arnt
b5856645d8 - Updated translations. 2014-10-30 22:29:28 -02:00
Alexandre Arnt
dfdefa2175 Merge branch 'master' of https://github.com/aarnt/octopi 2014-10-30 21:37:38 -02:00
Alexandre Arnt
608f3e9953 - 0.5 preparation...
- Fixed terminal selector dialog call.
2014-10-30 21:37:06 -02:00
Alexandre Arnt
d2d302db52 - Just a comment fix :-) 2014-10-29 22:06:14 -02:00
Alexandre Arnt
38ab007d82 - Show download size in MiB when system upgrade is called from notifier. 2014-10-29 21:46:18 -02:00
Alexandre Arnt
4d38d8077c Updated translations. 2014-10-29 21:33:41 -02:00
Alexandre Arnt
16bb4cb5f7 - BugFix: Save group panel state;
- Updated translations;
- Code cleanings.
2014-10-26 23:34:18 -02:00
Alexandre Arnt
6929d3ff40 - Small bug fixes. 2014-10-25 22:56:47 -02:00
Alexandre Arnt
2a8bdf122a - Some small bugfixes. 2014-10-25 16:26:55 -02:00
Alexandre Arnt
f34ead7705 - Output first SigLevels in "pacman.conf" (RepoEditor). 2014-10-25 11:57:04 -02:00
Alexandre Arnt
172c1da600 - BugFix: RepoEditor didn't take into account repo SigLevels while
saving .conf files.
2014-10-25 00:06:54 -02:00
Alexandre Arnt
074f1bd1ef - Remove unused method. 2014-10-22 21:29:40 -02:00
Alexandre Arnt
39bf2672b0 - Added compiler flag for dev only code. 2014-10-22 20:59:27 -02:00
Alexandre Arnt
349b8e5bea - Show MiB in Transaction Dialog download size. 2014-10-20 23:37:40 -02:00
Alexandre Arnt
be0f68f2ee - Added option to edit "octopi.conf" file in "File menu";
- Changed package size to MiB when it was > 1024 KiB;
- Updated translations.
2014-10-20 22:36:44 -02:00
Alexandre Arnt
de2d4ee25d - Updated translations. 2014-10-18 09:50:57 -03:00
Alexandre Arnt
99e29c06d4 - Added option "SyncDbHour" so notifier checks only when that specific
hour ticks, again once a day.
- Added C++11 support, so we can use "unique_ptr" instead deprecated
"auto_ptr".
2014-10-18 09:46:31 -03:00
Alexandre Arnt
43f12a8308 - Dot (".") is an important char in some validators :) 2014-10-12 14:46:08 -03:00
Alexandre Arnt
783bed6b98 - Unused .pri parameter ? 2014-10-12 14:16:34 -03:00
Alexandre Arnt
1d71432a35 - Unused code clean. 2014-10-12 11:18:20 -03:00
Alexandre Arnt
8332a9f33c - Reordering some tests... 2014-10-12 11:12:55 -03:00
Alexandre Arnt
608da40117 - Removed unused code;
- Updated translations.
2014-10-12 10:37:52 -03:00
Alexandre Arnt
3fa77f8a70 - Now notifier syncs db once a day and save last synced time;
- Added "sync db" menu option to notifier;
- Obligatory refactorings and code cleanings.
2014-10-11 23:30:52 -03:00
Alexandre Arnt
e84e34480f - Obligatory code cleanings;
- BugFix: Merged offa's pull request that fixed a bunch of things;
- Added support for hiding/showing Octopi window in the new KF5 notifier
code.
2014-10-10 22:03:37 -03:00
Alexandre Arnt
e7e97d9656 Merge pull request #50 from offa/minor_improvements
Minor (code-)improvements
2014-10-10 20:23:53 -03:00
offa
205012a91f Replaced ctor-init with initializer list. 2014-10-08 23:29:45 +02:00
offa
e6fd3b5033 Minor changes. 2014-10-08 23:17:14 +02:00
offa
8dac6402ff Duplicate expressions in the if-statement removed. 2014-10-08 23:11:40 +02:00
offa
901548d9e7 Initialized variables; under some circumstances they would have no value otherwise. 2014-10-08 23:05:03 +02:00
offa
ba2b6829a2 Fixed reorder warning. 2014-10-08 22:53:31 +02:00
Alexandre Arnt
521edcc6bb - Code cleaning. 2014-10-05 23:42:40 -03:00
Alexandre Arnt
4f4b5ccb7f - Refactor in function name. 2014-10-05 13:40:11 -03:00
Alexandre Arnt
4f7cf01786 - BugFix: Keep groups panel hidden (if it were before) after pressing
F12 or F10;
- Refactorings in SearchBar code;
- Added support for Ctrl+F in Output tab.
2014-10-04 22:08:22 -03:00
Alexandre Arnt
4de58a958e - Changed repoeditor default icon;
- Code refactorings here and there...
2014-10-02 23:58:02 -03:00
Alexandre Arnt
97ec878b4c - Removed unused method call. 2014-09-28 21:02:10 -03:00
Alexandre Arnt
a897f156f0 - Minor bug fixes and code cleaning. 2014-09-28 12:05:13 -03:00
A
3a5a95b32d - Cleaned unused code. 2014-09-24 21:18:53 -03:00
A
aca7585531 - Cleaned unused import. 2014-09-24 08:57:33 -03:00
A
6423c10a4b - Cleaned unused code. 2014-09-24 08:45:53 -03:00
Alexandre Arnt
81aeb44742 Cleaned unused code. 2014-09-23 23:35:45 -03:00
Alexandre Arnt
5415835d76 - Some code cleaning and fixes. 2014-09-21 00:55:44 -03:00
Alexandre Arnt
ab036cc13e Default to show groups panel... 2014-09-13 14:36:53 -03:00
Alexandre Arnt
b5b0feb542 - Show/hide groups panel config is now persisted;
- Some code cleanups in SettingsManager.
2014-09-13 11:40:27 -03:00
Alexandre Arnt
9ae2e1278d - Bugfixes in terminalselectordialog and info tab code. 2014-09-10 01:11:22 -03:00
Alexandre Arnt
fd55006f95 - Added QtQuick code for user change terminal (only if Qt >= 5.3). 2014-09-09 23:58:47 -03:00
Alexandre Arnt
fae6b51955 - Some fixes in repoeditor and notifier code (thanks to demm and philm);
- Some experiments with QML code.
2014-09-02 15:26:49 -03:00
Alexandre Arnt
5a0ac76494 - Big refactor in terminal related code. 2014-09-01 15:56:51 -03:00
A
897245766d - Cleaned unused SettingsManager methods. 2014-08-31 21:06:25 -03:00
A
aa435fef0d - BugFix in terminal validation code and mirrorCheck parameter in .conf
file.
2014-08-31 19:01:21 -03:00
Alexandre Arnt
751eab865b - Added support for the user to choose his terminal and bypass
mirrorcheck at startup, by editing ~/.config/octopi/octopi.conf.
2014-08-31 16:36:04 -03:00
Alexandre Arnt
8b06322427 - BugFix: mate-terminal is returning code 255 even when execution of
transaction was ok (thanks to ringo32).
2014-08-31 11:52:50 -03:00
Alexandre Arnt
13bb88e84e - BugFix: Suppress GConf error strings in output. 2014-08-30 22:32:27 -03:00
Alexandre Arnt
b6eef0830c - Two updated translations;
- A small bugfix in a connect statement.
2014-08-30 21:27:43 -03:00
Alexandre Arnt
cb0b033d16 - BugFix in icon assignment. 2014-08-30 18:58:13 -03:00
Alexandre Arnt
4992e8c725 - BugFix in repoeditor compiling with Qt5 (thanks to Philm);
- Merged changes from brcha (KNotifier).
2014-08-30 18:09:38 -03:00
Alexandre Arnt
0cd9398b83 - BugFix: Sometimes got a gconf bug string at sync db;
- Updated a bunch of translations;
- Bumped version number to 0.4.2.
2014-07-26 11:42:26 -03:00
A
6e8e09db42 - Updated indonesian translation. 2014-07-15 22:55:57 -03:00
A
e6b9550a3a - Changed version number... back do dev :) 2014-07-15 22:07:30 -03:00
A
cfa8111533 - BugFix: when searching AUR pkgs, given search string was not being
matched by package descriptions;
- Added support for new kcp (Go version).
2014-07-15 22:05:36 -03:00
Alexandre Arnt
767855b15f - Bumped version number to 0.4.1. 2014-07-12 09:50:45 -03:00
Alexandre Arnt
4f456456e8 - Updated basque translation. 2014-07-08 22:50:22 -03:00
Alexandre Arnt
2a1677c6ee Merge branch 'master' of https://github.com/aarnt/octopi
Conflicts:
	src/packagecontroller.h
2014-07-07 01:05:01 -03:00
Alexandre Arnt
2ada4e2333 - Added basque translation (thanks to tarteka);
- Created utils namespace (removed utils/processwrapper.*);
- Removed 'packagecontroller' file.
2014-07-07 01:02:29 -03:00
Alexandre Arnt
9e47ddcc5a - Added basque translation (thanks to tarteka);
- Created utils namespace (removed utils/processwrapper.*).
2014-07-07 00:46:31 -03:00
Alexandre Arnt
1ecfa48022 - Updated slovak translation;
- Updated README file.
2014-07-05 10:41:51 -03:00
Alexandre Arnt
bd3b812797 - BugFix: Tools menu was not being refreshed after a package
removal/installation.
- Added more characters in default SearchLineEdit validator.
2014-07-01 10:48:18 -03:00
Alexandre Arnt
6577fcff11 - Updated catalan and norwegian bokmål translations. 2014-07-01 09:25:28 -03:00
Alexandre Arnt
b86ee5dd07 - BugFix: Changed Yaourt references to 'AUR' in octopi-notifier code. 2014-06-23 15:26:52 -03:00
Alexandre Arnt
e2d13ef10b - Updated turkish translation (thanks to tulliana). 2014-06-21 18:26:30 -03:00
Alexandre Arnt
c3c383a9cb - BugFix: After a pkg list rebuild the Files and Info cache were not
being emptied;
- Now downgrading operations appears in orange in Output tab.
2014-06-21 17:53:48 -03:00
Alexandre Arnt
35ea5b463a - BugFix: When going to 'search by file', we have to restore all pkgs in
the list, first.
2014-06-21 16:24:17 -03:00
Alexandre Arnt
c884270dd2 Merge branch 'master' of https://github.com/aarnt/octopi 2014-06-21 11:39:49 -03:00
Alexandre Arnt
d825efdb0b - A new way to search by files: do not clear the pkg list, just position
at the found package name;
- Updated japanese translation;
- Removed last Yaourt references, to favour AUR instead.
2014-06-21 11:39:45 -03:00
Alexandre Arnt
49282078d0 - A new way to search by files: do not clear the pkg list, just position
at the found package name;
- Updated japanese translation.
2014-06-21 11:05:59 -03:00
Alexandre Arnt
e5e54acb41 - BugFix: When 'Search By file', always reset View mode (All/All) and
disable the menu.
2014-06-21 00:21:32 -03:00
Alexandre Arnt
54573e8c14 - BugFix: At start when there is no pacman db, octopi hangs (thanks to
anex);
- BugFix: include '*' in default string validator of searchlineedit.
2014-06-20 19:45:34 -03:00
Alexandre Arnt
ab0b464dac - Updated translations. 2014-06-20 18:04:19 -03:00
Alexandre Arnt
6411fd735c - Added japanese translation - thanks to (UTUMI Hirosi) utuhiro78;
- Updated czech translation.
2014-06-20 16:26:58 -03:00
Alexandre Arnt
67b95d8c73 - BugFix: The 'Enter' key (numeric keyboard) is now supported. 2014-06-20 15:41:58 -03:00
Alexandre Arnt
bee9924a29 - Updated some translations. 2014-06-20 01:24:29 -03:00
Alexandre Arnt
235ea7d982 Merge branch 'master' of https://github.com/aarnt/octopi 2014-06-20 01:24:21 -03:00
Alexandre Arnt
bec920f07f Merge branch 'master' of https://github.com/aarnt/octopi 2014-06-20 01:20:59 -03:00
Alexandre Arnt
d0e0e61c85 - Switched position of name/description in Search menu. 2014-06-20 01:20:54 -03:00
Alexandre Arnt
786050926c - Switched position of name/description in Search menu. 2014-06-20 00:53:45 -03:00
Alexandre Arnt
88a75d0629 - BugFix: kcp search stoped working. 2014-06-20 00:21:57 -03:00
Alexandre Arnt
1464355c71 - BugFix: if user did not enter a file in Search by file, then no
results!
2014-06-19 23:37:58 -03:00
Alexandre Arnt
a8635c059d - Some coding refactorings regarding Yaourt/AUR;
- Added Search by file feature (pacman -Qo).
2014-06-19 23:19:55 -03:00
Alexandre Arnt
2490e95516 - BugFix: Download and installed size info at info tab. 2014-06-19 12:33:26 -03:00
Alexandre Arnt
74b793ee74 - Added 'installed size' information in package tooltips. 2014-06-19 11:21:00 -03:00
Alexandre Arnt
8b69cecd4a - Updated portuguese (Portugal) translation. 2014-06-18 21:05:27 -03:00
Alexandre Arnt
85477cf6bc - BugFix: Compile error in mainwindow_events.cpp with Qt4 libs. 2014-06-15 13:53:14 -03:00
Alexandre Arnt
fc69de5d66 - BugFix: Ctrl and Shift key pkg actions not behaving right in Qt5
builds.
2014-06-14 23:02:21 -03:00
Alexandre Arnt
53720a5b23 - BugFix: Chakra does not have popularity support in CCR. 2014-06-14 17:52:24 -03:00
Alexandre Arnt
784de2139f - BugFix: When clicking a pkg on the outdated list, it could scroll to a
wrong pkg info.
2014-06-08 11:56:14 -03:00
Alexandre Arnt
fd884ca728 - BugFix in ArchBang edit file code. 2014-06-07 12:38:06 -03:00
Alexandre Arnt
52d4b6f7b0 - Missed file in commit :-) 2014-06-07 12:28:09 -03:00
Alexandre Arnt
e9c0c24829 - BugFix: Adapted ArchBang changes. 2014-06-07 12:27:36 -03:00
Alexandre Arnt
fba995f794 - Updated es_AR translation. 2014-06-07 09:50:11 -03:00
Alexandre Arnt
13d2fd0c5b - String breaks to beautify code. 2014-06-05 21:54:21 -03:00
Alexandre Arnt
d62304a988 - Bugfix in copy to clip code. 2014-06-04 22:08:59 -03:00
Alexandre Arnt
8d51bc9133 - Ctrl+C over an item in Files tab copies it's full path to Clipboard. 2014-06-04 22:00:55 -03:00
Alexandre Arnt
1265a76d72 - Updated translations;
- Small fixes in packagemodel/package code (thanks to tbinkau).
2014-06-04 21:43:21 -03:00
Alexandre Arnt
84b1548106 Merge pull request #39 from tbinkau/fb3
small bugfixes
2014-06-04 15:32:59 -03:00
Thomas Binkau
19f65cc8fb small bugfixes
- variable used before init (minor)
- import uses incorrect check for empty pacman group (minor)
2014-06-04 19:44:26 +02:00
Alexandre Arnt
b9b048a4c3 - Reworked code to count installed packages (based on filters). 2014-06-04 00:13:00 -03:00
Alexandre Arnt
dfba96224d - Leave most actions disabled while mirror-checking... 2014-06-01 14:57:33 -03:00
Alexandre Arnt
728b04aa53 - Removed unused Ctrl+N help text;
- Updated es_AR translation.
2014-06-01 11:57:47 -03:00
Alexandre Arnt
157c0c3e4e - Updated es_AR translation. 2014-06-01 11:29:32 -03:00
Alexandre Arnt
3fc552312a - Bumped version number in PKGBUILD file. 2014-06-01 11:06:27 -03:00
Alexandre Arnt
29359ea87f - Leave some actions disabled before building pkg list;
- Added es_AR translation (thanks to javier).
2014-06-01 10:58:47 -03:00
Alexandre Arnt
7620e1cf22 - 0.4.1 dev starts... 2014-05-31 11:51:26 -03:00
Alexandre Arnt
cebe039944 - Octopi 0.4.0 released. 2014-05-24 23:31:59 -03:00
Alexandre Arnt
6eecb0f697 - String fix in CHANGELOG. 2014-05-24 23:30:27 -03:00
Alexandre Arnt
83e191b44c - More LXQt support changes. 2014-05-24 17:29:47 -03:00
Alexandre Arnt
e6667ebd81 - Better stick with xterm dependency, for scary moments ;-P 2014-05-24 17:06:33 -03:00
Alexandre Arnt
92d33c6c4c - Added support for LxQt DE. 2014-05-24 16:25:01 -03:00
Alexandre Arnt
35fb7ae3ff - Changed some Antergos wm settings. 2014-05-24 14:17:31 -03:00
Alexandre Arnt
bb233dbd91 - Some changes in wm guessing preferences. 2014-05-24 12:44:34 -03:00
Alexandre Arnt
a4239a518c - BugFix: Open Root terminals while in gnome/cinnamon. 2014-05-24 12:32:01 -03:00
Alexandre Arnt
1d71716bb2 - Changed some gnome tools calling. 2014-05-24 12:22:07 -03:00
Alexandre Arnt
3b3ae1d5c3 - Added support for Antergos distro (thanks to Yoyo). 2014-05-24 11:45:21 -03:00
Alexandre Arnt
1f46765b00 - BugFix: Sync db with downloading string. 2014-05-23 13:06:13 -03:00
Alexandre Arnt
41e10ddf7c - Changed notify-send timeout. 2014-05-22 21:32:18 -03:00
Alexandre Arnt
535fa8243a - BugFix: pacaur upgrade code. 2014-05-22 21:24:06 -03:00
Alexandre Arnt
08727254f6 - BugFix: Pacaur upgrade pkgs code. 2014-05-22 21:09:47 -03:00
Alexandre Arnt
c35347f0a5 - Pacaur upgrade code refactoring. 2014-05-22 20:30:45 -03:00
Alexandre Arnt
a514c716cf - Changed notify-send timeout. 2014-05-22 19:53:53 -03:00
Alexandre Arnt
21b6f4c05f - BugFix: Synchronize pkg list in certain systems. 2014-05-22 18:36:35 -03:00
Arnt
b617c69fd3 - Changed urxvtc terminal launch code. 2014-05-21 23:12:44 -03:00
Arnt
642627648d Changed urxvt launch code. 2014-05-21 22:49:29 -03:00
Arnt
1627fffa8b - Uses urxvtc if the deamon is running. 2014-05-21 22:18:49 -03:00
Arnt
1b3a4207fa - BugFix: Urxvt starting code. 2014-05-21 21:42:32 -03:00
Arnt
286220d07a - Back to "pacman -Sy" when syncing dbs running as root. 2014-05-20 22:43:20 -03:00
Alexandre Arnt
3566a30074 - Running as root in KDE... 2014-05-20 19:09:51 -03:00
Alexandre Arnt
1bd98c9c38 - BugFix: Transparent octopi notifier icon no longer shows a white bar
in the eyes (thanks to Anke Boersma);
- Transparent octopi notifier icon tooltip added.
2014-05-19 23:10:07 -03:00
Alexandre Arnt
da16c21ab5 - BugFix: Fixed a jump bug when key-navigating in pkg list with Qt5
octopi;
- Updated asturian translation.
2014-05-19 21:49:03 -03:00
Alexandre Arnt
c048408aba - BugFix: When a pkg is outdated, show all available info,
- Updated viatnamese translation.
2014-05-19 08:56:03 -03:00
Alexandre Arnt
9baef907d2 - BugFix: Get list of outdated pkgs with pacaur was not working. 2014-05-18 09:31:48 -03:00
Alexandre Arnt
d743be5ba6 - BugFix: Disable group widget while searching for AUR packages. 2014-05-17 22:38:48 -03:00
Alexandre Arnt
c74553085e - Fix popularity column issues for AUR searches;
- Added support for pacaur tool.
2014-05-17 22:17:55 -03:00
Alexandre Arnt
0cafd02010 - Patched transactiondialog so it doesn't show Yes button while in
ArchBSD too.
2014-05-17 16:45:07 -03:00
Alexandre Arnt
1e94463a06 - Added support to Netrunner news. 2014-05-17 15:39:05 -03:00
Alexandre Arnt
96f096c764 - BugFix: Only show popularity column when needed. 2014-05-17 11:09:27 -03:00
Alexandre Arnt
931e86c7b5 - A bunch of code cleanings;
- Fixed remove kcp pkg code.
2014-05-17 09:44:37 -03:00
Alexandre Arnt
0b92da973a - Changed QString toAscii() to toLatin1() method. 2014-05-16 22:00:06 -03:00
Alexandre Arnt
2efc5d4218 - KCP group name refactored :-) 2014-05-15 22:58:37 -03:00
Alexandre Arnt
b861cc8986 - BugFix: AUR search. 2014-05-15 22:47:31 -03:00
Alexandre Arnt
bcda9c21d5 - Initial support for kcp in KaOS (thanks to Cellix). 2014-05-15 22:40:49 -03:00
Arnt
3e4208ffc2 - Refactor in method for getting number of votes in AUR. 2014-05-12 22:38:47 -03:00
Arnt
7ad9cd61bf - BugFix: Which output in BSD systems. 2014-05-11 11:54:46 -03:00
Alexandre Arnt
fac2a3b0b2 - BugFix: system upgrade button could not appear in Yaourt mode. 2014-05-10 20:36:05 -03:00
Alexandre Arnt
627307e8a5 - Updated turkish translation. 2014-05-10 20:01:34 -03:00
Alexandre Arnt
75cdb0fb7f - Refactor in debug message. 2014-05-10 19:58:12 -03:00
Alexandre Arnt
7522bd8c42 - Reverted wrong commit. 2014-05-10 19:03:39 -03:00
Alexandre Arnt
35ae99199e - Added title to the urxvt terminal. 2014-05-10 18:24:59 -03:00
Alexandre Arnt
282e5df505 - BugFix: Updated MooOS terminal commands;
- BugFix: Reworked ArchBSD discover logic.
2014-05-10 18:05:52 -03:00
Alexandre Arnt
df119a577a - New logic for ArchBSD guessing. 2014-05-10 16:55:18 -03:00
Alexandre Arnt
8b0664423b - Removed xterm from dependencies in PKGBUILD file. 2014-05-10 11:58:07 -03:00
Alexandre Arnt
fbe76c37f6 - BugFix: updated installgroup logic. 2014-05-10 10:30:55 -03:00
Alexandre Arnt
63c42435db - BugFix: warning in doInstallLocalPackages. 2014-05-10 10:23:25 -03:00
Alexandre Arnt
2408a07190 - BugFix: Show warning when user do not have kdesu/gksu in install local
pkgs.
2014-05-10 10:20:56 -03:00
Alexandre Arnt
2af3c78c71 - BugFix: If we do not have kdesu/gksu, we do not show sys upgrade
dialog.
2014-05-10 10:15:58 -03:00
Alexandre Arnt
48f42e4a25 - BugFix: doRemovePacmanLockFile should return a bool to indicate
success.
2014-05-10 10:07:31 -03:00
Alexandre Arnt
af1c0768ac - Changed logic in pkg group actions. 2014-05-10 09:54:40 -03:00
Alexandre Arnt
ed5f19a88a - BugFixes in install group and install yourt logic. 2014-05-10 09:36:51 -03:00
Alexandre Arnt
3441ecf6d3 - Forgot to add asturian files to repo. 2014-05-09 23:51:37 -03:00
Alexandre Arnt
3c335bf66f - Added asturian translation in Qt5 builds (thanks to Llumex03);
- Updated dutch and slovak translations.
2014-05-09 22:54:44 -03:00
Alexandre Arnt
cad652e031 - BugFix: When in Yaourt mode, appicon would change to green color even
with outdated packages.
2014-05-08 20:45:01 -03:00
Alexandre Arnt
f956e0c17d Merge translations 2014-05-08 20:20:24 -03:00
Alexandre Arnt
af9934e308 - Added support for ArchBSD news (thanks to bkc_);
- Updated german translation.
2014-05-08 20:17:36 -03:00
Alexandre Arnt
36574af264 - Added support for ArchBSD news (thanks to bkc_). 2014-05-08 20:12:52 -03:00
Alexandre Arnt
a39db6c102 - Updated russian, uzbek and czech translations;
- Bumped version to 0.4.0 RC.
2014-05-07 21:46:19 -03:00
Arnt
5de4e3a511 - Added support for mooOS (thanks to pdq);
- Updated color status of mirror-check's 'not found repos'.
2014-05-06 21:45:00 -03:00
Alexandre Arnt
12f12f0e61 Merge branch 'master' of https://github.com/aarnt/octopi 2014-05-06 09:14:44 -03:00
Alexandre Arnt
63f708fb72 - Updated translations. 2014-05-06 09:11:59 -03:00
Arnt
dc776b673a - Mirror-check output changes... 2014-05-04 21:18:30 -03:00
Alexandre Arnt
e11c893475 - BugFix: removed color codes in mirror-check output;
- Updated indonesian translation.
2014-05-04 19:05:51 -03:00
Alexandre Arnt
79ce221302 - Removed unused #include clause in strconstants.h. 2014-05-04 11:57:09 -03:00
Alexandre Arnt
40470fabd9 - More code clean (unused methods). 2014-05-04 11:06:00 -03:00
Alexandre Arnt
d726dedc67 - Switched to repoeditor/repoentry.* files;
- BugFix: Removed color code in not synched mirror check repos (thanks
to AlmAck, from Chakra);
2014-05-04 10:45:20 -03:00
Alexandre Arnt
dfb222c581 - Updated italian translation;
- Stripped some unused code in repoconf.*.
2014-05-04 09:22:39 -03:00
Alexandre Arnt
b26d488be9 - Updated translations. 2014-05-04 08:08:45 -03:00
Alexandre Arnt
aacc0667f9 - Updated some translations. 2014-05-03 20:33:51 -03:00
Alexandre Arnt
8e606cf6b1 - BugFix: KaOS and Chakra do not use popularity column yet;
- Updated translatable strings;
- Updated pt_BR translation.
2014-05-03 16:40:03 -03:00
Alexandre Arnt
8c538ad6af - Switched to "pacman -Syy" command when synching. It's safer. 2014-05-03 15:42:18 -03:00
Alexandre Arnt
97123b05cc - BugFix: While in KaOS, let's hide popularity column for now;
- BugFix: Let's always refresh pkg counters after messing with View's
filter.
2014-05-03 15:28:05 -03:00
Alexandre Arnt
77c0fabb74 Merge branch 'master' of https://github.com/aarnt/octopi 2014-05-03 14:48:10 -03:00
Alexandre Arnt
a554f17cbf - Added popularity column (number of votes) in AUR/CCR mode (thanks to
tbinkau);
- Added more filter options in View menu.
2014-05-03 14:46:20 -03:00
Alexandre Arnt
79adad4cf2 - Added popularity column (number of votes) in AUR/CCR mode (thanks to
tbinkau);
- Added more filter options in View menu.
2014-05-03 14:44:52 -03:00
Alexandre Arnt
5488697d3e - BugFix: System upgrade can not be available while in yaourt mode;
- BugFix: Switching faster to yaourt mode if text field is empty.
2014-05-01 22:12:38 -03:00
Alexandre Arnt
906d9970d8 - BugFix: Ctrl+A is available in the pkg list panel. 2014-04-26 23:08:42 -03:00
Alexandre Arnt
40456e7961 - Updated CHANGELOG file. 2014-04-23 01:43:07 -03:00
Alexandre Arnt
52356e6b35 Merge pull request #31 from tbinkau/master
sorting first column will include package name as second sort criteria
2014-04-24 08:35:06 -03:00
Thomas Binkau
3d7f48b26d sorting first column will include package name as second sort criteria 2014-04-23 08:49:16 +02:00
Alexandre Arnt
6fa3b3f4ba - Updated CHANGELOG;
- BugFix: some notifier menu icons were not showing in xfce;
- Removed getIconOpenDirectory (same as getIconFolder).
2014-04-23 00:43:13 -03:00
Alexandre Arnt
77f9d237e4 - BugFix: openurl code when the clicked pkg is not at the list of
packages;
- BugFix: key navigation while in package list.
2014-04-23 00:00:38 -03:00
Alexandre Arnt
117003345d Merge pull request #30 from tbinkau/master
Merge BIG changes in model...
2014-04-23 21:24:52 -03:00
Thomas Binkau
bfa97587b9 Merge remote-tracking branch 'upstream/master'
Conflicts:
	CHANGELOG
	notifier/octopi-notifier/mainwindow.cpp
	src/mainwindow.cpp
	src/mainwindow_transaction.cpp
	src/searchlineedit.cpp
2014-04-22 21:08:42 +02:00
Thomas Binkau
a121036a77 reintegrate branch feature_pkgModel @21e9c87
- sorting first column
- first display of package tv
- concurrency fix for group members update
2014-04-22 20:34:05 +02:00
Arnt
50e15c94f5 - BugFix: the new define "OCTOPI_EXTENSIONS" was misplaced. 2014-04-21 21:56:12 -03:00
Alexandre Arnt
92770c720b - BugFix: Honor KDE icon for system upgrade in notifier. 2014-04-21 15:39:36 -03:00
Alexandre Arnt
e372b2de97 - BugFix: No graphical system upgrades while in Chakra. 2014-04-21 15:27:08 -03:00
Alexandre Arnt
97dc486b7b - BugFix: Let's not sendNotification to the desktop if spun is running! 2014-04-21 15:14:29 -03:00
Alexandre Arnt
9cb286be10 - Cleaned unused code;
- Fixed possible string bugs in syncdatabase code.
2014-04-21 12:30:08 -03:00
Alexandre Arnt
55fbb182a0 - Patched repoeditor to support QtSingleApplication. 2014-04-21 12:01:13 -03:00
Alexandre Arnt
4e6eae79e4 - BugFix in main.cpp code. 2014-04-21 08:30:32 -03:00
Alexandre Arnt
9f5a8c1640 - Reworked code to sysupgrade-noconfirm 2014-04-20 19:30:23 -03:00
Alexandre Arnt
fc3ad7e30b - Added sysupgrade noconfirm option to notifier. 2014-04-20 11:11:56 -03:00
Alexandre Arnt
8eab440bf2 BugFix: Fixed CCR (Chakra) package installation/removal (thanks to
dmnmsc).
2014-04-20 10:21:41 -03:00
Arnt
1771a3227a - Updates in README and CHANGELOG. 2014-04-19 22:53:59 -03:00
Arnt
3aa128d934 - Add new octopi parameter "-sysupgrade-noconfirm", so it jumps to the
upgrade process as soon as it is started, without asking confirmation
(needed by notifier in certain conditions).
2014-04-19 22:42:55 -03:00
Thomas Binkau
d8d6b1ffbf Refactored the packageView to use a single model.
Imho much better to read and build upon. Also it should be a bit faster.
2014-04-19 00:21:44 +02:00
Thomas Binkau
92270e91ec merged upstream change 2014-04-18 10:44:01 +02:00
Alexandre Arnt
62420fd91a Merge branch 'master' of https://github.com/aarnt/octopi 2014-04-17 22:17:56 -03:00
Arnt
b0ad9bc94d - Added Jordi (dmnmsc) in THANKS. 2014-04-18 18:37:46 -03:00
Arnt
3f48fe6a99 - BugFix: stylesheet bugs while in Chakra. 2014-04-18 18:23:12 -03:00
Arnt
36f7326596 - BugFix: Octopi's mirror-check was not outputing errors;
- Updated installation notes for KDE-centric distros.
2014-04-18 18:04:32 -03:00
Alexandre Arnt
1363079150 - BugFix: Chakra ccr was not working (thanks to dmnmsc). 2014-04-17 22:16:27 -03:00
Thomas Binkau
aa720896b4 Merged upstream changes
BugFix: Now Shift+F3 and F3 search keys (and also Esc) work outside
SearchLineEdit widget.
BugFix: fixed freeze for install orphaned/yaourt package (thanks to
tbinkau).
BugFix: fixed notify-send code in octopi-notifier (thanks to vedgy).
2014-04-18 01:03:46 +02:00
Alexandre Arnt
f9e1b5683b - Changed method for searching for a package URL. 2014-04-17 16:40:18 +00:00
Alexandre Arnt
1d6c60a79a - BugFix: Esc key now works outside SearchLineEdit widget. 2014-04-17 16:18:01 +00:00
Alexandre Arnt
50102b318e - Updated some translations;
- BugFix: Now user can use F3 and Shift+F3 buttons outside
SearchLineEdit;
- BugFix: Now konsole can be used with yaourt support while in KDE
(thanks to Thomas Binkau).
2014-04-17 15:23:18 +00:00
Alexandre Arnt
248ee6e2a6 Merge pull request #27 from tbinkau/master
fixed freeze for install orphaned/yaourt package
2014-04-17 14:04:00 +00:00
Thomas Binkau
765391b9f4 fixed freeze for install orphaned/yaourt package
when installing an AUR package (directly) via context menu from the
package list the group tree would freeze and octopi wouldnt shut down
afterwards. this happened because octopi didnt find a suitable terminal
but did wait for its execution.
This fix add "konsole" as terminal for kde and will abort in case no
suitable terminal was found. also the info tab will not indicate
successfull completion in this case.
2014-04-16 20:23:14 +02:00
Alexandre Arnt
4d9f0342b5 BugFix: Stylesheet code in SearchLineEdit was buggy. 2014-04-10 23:38:32 -03:00
Alexandre Arnt
c7fe445508 - Updated finish translation. 2014-04-10 00:25:42 +00:00
Manjaro Linux
493b2d6906 Merge pull request #25 from gcala/master
Change some gui details when using Chakra
2014-04-06 19:21:12 +02:00
Alexandre Arnt
22ce7d4099 - Updated two icons from KaOS icon set;
- Added/Changed some comments.
2014-04-06 15:19:41 +00:00
Giuseppe Calà
2d3ec9d137 Merge remote-tracking branch 'upstream/master' 2014-04-06 16:06:39 +02:00
Giuseppe Calà
ba23299cdc Give native look to search field when using Chakra.
Using QPalette to change its colors.
2014-04-06 15:59:59 +02:00
Alexandre Arnt
e39e43d8a9 - Updated hungarian translation. 2014-04-06 13:52:11 +00:00
Giuseppe Calà
8f76160d7c Use system windows style with Chakra 2014-04-06 12:29:57 +02:00
Manjaro Linux
35af4fe25c Merge pull request #24 from gcala/master
Fix: updated Chakra rss2 url
2014-04-06 10:29:49 +02:00
Giuseppe Calà
4c1b8d00a9 Fix: updated Chakra rss2 url 2014-04-06 09:57:37 +02:00
Philip
590098cc08 Manjaro RSS Feed
- restore back to http
- when we use https we can't post videos on our blog
- this might change later
2014-04-06 09:42:39 +02:00
Philip
4a703e04c9 Fix manjaro rss feed 2014-04-05 15:29:03 +02:00
Philip
2122f16622 update PKGBUILD 2014-04-05 12:07:20 +02:00
Alexandre Arnt
c230ccf09d Changes in CHANGELOG file 2014-04-04 11:06:35 +00:00
Alexandre Arnt
047560a351 Merge branch 'master' of https://github.com/aarnt/octopi 2014-04-04 11:06:26 +00:00
Alexandre Arnt
128addb910 Merge branch 'master' of https://github.com/aarnt/octopi 2014-04-04 11:05:15 +00:00
Alexandre Arnt
d47da6c11a - Code refactorings;
- BugFix: While in a transaction of remove/install pkgs, transaction
dialog was named "Form".
2014-04-04 11:05:01 +00:00
Alexandre Arnt
2a3cc4d8db - Code refactorings;
- BugFix: While in a transaction of remove/install pkgs, transaction
dialog was named "Form".
2014-04-04 11:02:46 +00:00
Alexandre Arnt
3861b0a2df - Updated romanian translation;
- Tab fixes in strconstants.h.
2014-04-04 10:26:10 +00:00
Manjaro Linux
975e99fd35 Merge pull request #23 from gcala/master
Added ccr support for Chakra.
2014-04-03 19:06:27 +02:00
Giuseppe Calà
26b534a9f1 Added ccr support for Chakra.
Unfortunately, had to disable outdated check since ccr not provides '-Qua' option.
2014-04-03 17:04:14 +02:00
Alexandre Arnt
872600c14e - Some changes in the tools menu code. 2014-04-03 01:35:57 +00:00
Manjaro Linux
d0a2ca8d65 Merge pull request #22 from gcala/master
Merge Tool menu by gcala
2014-04-02 20:36:57 +02:00
Giuseppe Calà
e9963e5b69 added translations 2014-04-02 15:41:19 +02:00
Giuseppe Calà
4aef61a74d removed useless files 2014-04-02 15:13:02 +02:00
Giuseppe Calà
3f8fe577f6 New Tools Menu 2014-04-02 15:08:27 +02:00
Alexandre Arnt
e80835ba1f - Added some KaOS conditional. 2014-03-30 16:46:30 -03:00
Alexandre Arnt
3cea7de87f - Updated bulgarian and serbian (latin) translations;
- Merged Giuseppe Calà (gcala) code from Oktopi changes.
2014-03-30 17:49:50 +00:00
Alexandre Arnt
820dbdddf4 Merge pull request #21 from gcala/master
Use theme icons when possible
2014-03-30 16:32:20 +00:00
Giuseppe Calà
1b0cb23c93 Revisited icon theme support 2014-03-30 15:28:52 +02:00
Giuseppe Calà
f7fcfcc31f use theme icons when possible 2014-03-29 16:14:56 +01:00
Alexandre Arnt
abbe406cac - Updated INSTALL file;
- Removed unneeded pro.user file;
- Updated some comments.
2014-03-27 22:02:46 -03:00
Alexandre Arnt
a029a5fbb3 - Filelist search now searches directories too;
- Updated hebrew translation.
2014-03-23 08:47:38 -03:00
Alexandre Arnt
e28b984c9a - More bugfixes in filelist code;
- BugFix in showFullPathOfItem code.
2014-03-21 15:51:04 -03:00
Alexandre Arnt
786aa46e04 - More bugfixes in the filelist logic. 2014-03-21 11:35:53 -03:00
Alexandre Arnt
7e7053dea6 - BugFix: Package::getContents() got buggy strings from pkgfile output
compromising filelist of uninstalled packages.
2014-03-20 23:49:47 -03:00
Alexandre Arnt
580a96ca60 - More bugfixes for running as root in KDE. 2014-03-20 23:01:56 -03:00
Alexandre Arnt
56ef8c1604 - Updated polish translation. 2014-03-20 22:07:17 +00:00
Alexandre Arnt
d889d4241b - BugFix: Files tab presented some nasty results sometimes and even a
GPF when it found symlinks to directories;
- Updated octopi main icons (thanks to Anke Boersma).
2014-03-20 21:54:54 +00:00
Arnt
a14acdaf59 Bugfix in define constant 2014-03-20 12:26:05 -03:00
Arnt
db321da222 - BugFix: running as root was broken in KDE;
- BugFix: The preventing code for always refresh the pkg list was
flawed;
- BugFix: hasInternetConnection code fixed to improve mirror-check
speed.
2014-03-20 12:24:32 -03:00
Arnt
eee3de641e - BugFix: running as root was broken in KDE;
- BugFix: The preventing code for always refresh the pkg list was
flawed;
- BugFix: hasInternetConnection code fixed to improve mirror-check
speed.
2014-03-20 11:17:57 -03:00
Arnt
1d81d90e01 - Refactorings here and there to make Octopi more Chakra friendly;
- Updated translations.
2014-03-19 21:21:45 -03:00
Arnt
6eb9f6753f - Updated some icons to unclutter the UI (thanks to Anke Boersma). 2014-03-19 19:03:44 -03:00
Arnt
49c399806e - BugFix in mirror-check code call (sometimes it was not called);
- Refactoring in some code to not generate translatable strings;
- Updated README file;
- Updated some translations;
2014-03-19 17:29:24 -03:00
Alexandre Arnt
5f2e72cd12 Merge branch 'master' of https://github.com/aarnt/octopi 2014-03-03 03:27:48 -03:00
Alexandre Arnt
75dd3fb8e3 - BugFix: getBuildDate was returning invalid dates in some cases. 2014-03-03 03:26:56 -03:00
Alexandre Arnt
812a8e3558 - BugFix: getBuildDate was returning invalid dates in some cases. 2014-03-03 03:22:02 -03:00
Alexandre Arnt
0fb43b9363 - Started 0.4 dev cycle;
- Updated turkish translation.
2014-03-02 21:53:19 -03:00
Alexandre Arnt
c19d9fa182 - Updated Portuguese (Portugal) translation;
- Tagged version number 0.3.2.
2014-02-14 22:58:58 -02:00
Alexandre Arnt
29d4bd7cd8 - Updated czech translation. 2014-02-03 21:05:28 -02:00
Alexandre Arnt
a2f52ba688 - Updated CHANGELOG. 2014-02-02 15:26:44 -02:00
Alexandre Arnt
39bd74c201 - BugFix: Navigating in the package list using [A..Z] keys did not work
as expected.
2014-02-02 15:25:17 -02:00
Alexandre Arnt
acea7c3f07 - BugFix in finish translation (thanks to SamiPerkele). 2014-02-01 09:27:46 -02:00
Alexandre Arnt
4a78bc9acc - BugFix: When the package list is filtered and you click in a package
which is in the outdated package list, you are redirected to a blank
information tab.
2014-01-30 09:23:16 -02:00
Alexandre Arnt
edbfa15f91 - Deleted misplaced header file. 2014-01-29 21:47:18 -02:00
Alexandre Arnt
1fdef5eb0f - Small code refactor;
- BugFix: when mirror checking, disable sysupgrade button.
2014-01-28 23:19:03 -02:00
Alexandre Arnt
cc8aee4fb4 - BugFix: Enable system upgrade button right after a sync db finds new
updates;
- Removed 3 KAOS defines.
2014-01-28 22:36:56 -02:00
Alexandre Arnt
a29934e8c1 - Put the mirror-check button at the far right. 2014-01-27 22:49:31 -02:00
Alexandre Arnt
b780cb234b - Code cleanings;
- Added icon for mirror-check while in KaOS;
- Does a mirror-check at startup while in KaOS.
2014-01-26 20:55:48 -02:00
Alexandre Arnt
7cdee5a619 - Hidden feature: ctrl+shift+D to show the list of packages with no
description.
2014-01-26 18:10:00 -02:00
Alexandre Arnt
515688be68 sysupgrade icon in notifier 2014-01-26 16:57:46 -02:00
Alexandre Arnt
928fafe636 Cleaned unused code;
Added icon for system upgrade;
Added system upgrade button in octopi's toolbar;
BugFix: When the groups button is pressed and the lower pane is
maximized, the former is hidden by the later;
BugFix: When the user had no yaourt in the system, there were a zombie
octopi process 'left running'.
2014-01-26 16:52:51 -02:00
Alexandre Arnt
54212085d9 Cleaned unused code;
Added icon for system upgrade;
Added system upgrade button in octopi's toolbar;
BugFix: When the groups button is pressed and the lower pane is
maximized, the former is hidden by the later;
BugFix: When the user had no yaourt in the system, there were a zombie
octopi process 'left running'.
2014-01-26 16:06:16 -02:00
Alexandre Arnt
ca49540cb2 - A small comment added... 2014-01-14 16:33:56 -02:00
Alexandre Arnt
90e3796c9a - Updated turkish translation;
- Updated CHANGELOG file;
- Bumped version number to 0.3.1.
2014-01-14 13:55:26 -02:00
Alexandre Arnt
02165991fe - Calls doRemovePacmanLockFile before all major transactions. 2014-01-18 11:39:14 -02:00
Alexandre Arnt
378b563dad - Let's deal with packages with "pkg.tar*" pattern. 2014-01-14 22:33:09 -02:00
Alexandre Arnt
11d37767c5 - BugFix: When changing groups too fast the program might crash. 2014-01-14 22:21:11 -02:00
Alexandre Arnt
9af37e9401 - Made octopi notifier faster, striping some code. 2014-01-06 23:46:44 -02:00
Alexandre Arnt
891915ec82 - BugFix in transparent octopi icon;
- BugFix: refresh the GUI while in refreshAppIcon code;
- Switched from pacman -Syy to -Sy in pacmanhelper code.
2014-01-06 22:31:38 -02:00
Alexandre Arnt
ce61acacc1 - Code cleanings. 2014-01-05 23:38:59 -02:00
Alexandre Arnt
a0bfee3f9e - BugFix: In the local package installation, it's better to stick with
the *.pkg.tar* pattern.
2014-01-05 23:25:59 -02:00
Alexandre Arnt
3658709051 - Added new transparent octopi icon (to use when the notifier is
checking for changes...);
- Some code cleanings and little refactorings;
2014-01-05 20:20:04 -02:00
Alexandre Arnt
e0c10b0fe5 - Made octopi-notifier compatible with Qt5. 2014-01-04 00:17:47 -02:00
Alexandre Arnt
798f587c4f - BugFix: Prevent header resizing in File and Transaction tabs;
- Added support for Qt5.
2014-01-03 23:55:57 -02:00
Alexandre Arnt
8ad766b8a6 - BugFix in code typos. 2014-01-02 23:05:02 -02:00
Alexandre Arnt
bcedb72249 Merge branch 'master' of https://github.com/aarnt/octopi
Conflicts:
	src/mainwindow_transaction.cpp
2014-01-02 22:59:19 -02:00
Alexandre Arnt
0238c0234e - After doing an install or remove while in a package group, always
return to all packages.
2014-01-02 22:57:20 -02:00
Alexandre Arnt
1f983e495c - After doing an install or remove while in a package group, always
return to all packages.
2014-01-02 22:19:10 -02:00
Alexandre Arnt
9124d2f1e2 - Added pkgfile support in KaOS too. 2013-12-28 22:45:24 -02:00
Alexandre Arnt
ef70d2aa24 - BugFix: Use new KDE4 tools to deal with files. 2013-12-28 23:23:40 -02:00
MAJO
4ed73e110b - Bugfixes in KaOS support;
- BugFix in install local package code.
2013-12-28 21:42:49 -02:00
Alexandre Arnt
fe479d09fb - Added slovak translation;
- Refactorings in package group methods;
- Some bugfixes in Kaos support.
2013-12-28 20:37:19 -02:00
Philip
b7ea5564cb Bugfix
- fix issue reported here: http://forum.manjaro.org/index.php?topic=9527.0
2013-12-26 17:13:16 +01:00
Alexandre Arnt
2cc5ef39f8 - BugFix in refreshGroupsWidget code. 2013-12-22 16:02:17 -02:00
Alexandre Arnt
e6441f7bf8 - Removed separator before the Group toolbutton. 2013-12-22 15:12:15 -02:00
Alexandre Arnt
c4e0c492f1 - Added new Groups toolbutton. 2013-12-22 13:48:55 -02:00
Alexandre Arnt
c3c5aafac6 - BugFix: We have to refresh package groups after transactions are
finished.
2013-12-22 11:58:44 -02:00
Alexandre Arnt
6524ea60ad - Package groups selection changed to a QTreeWidget. 2013-12-22 00:36:01 -02:00
Alexandre Arnt
628660c086 - Updated turkish translation. 2013-12-16 21:14:37 -02:00
Alexandre Arnt
6ba7859027 - BugFix in notifier: When the user cancel the update, "system update"
option wasn't enabled.
2013-12-15 11:43:02 -02:00
Alexandre Arnt
bc61ca8672 - Updated turkish translation;
- Added ukrainian translation.
2013-11-30 13:55:31 -02:00
Alexandre Arnt
62b8fda959 - Use just filename in transaction dialog while in local package
installation.
2013-11-24 14:49:19 -02:00
Alexandre Arnt
ee65991e8d - Added support to installation of local packages with GUI feedback; 2013-11-24 12:56:36 -02:00
Arnt
0d6cccf8f0 BugFix: When inserting an optional dependency package or removing a
dep, first searches into transaction queue for them.
2013-11-19 22:43:47 -02:00
Arnt
096068ccc3 - Changed minimun window size to 820 X 520 - thanks to Swâmi Petaramesh! 2013-11-17 09:37:25 -02:00
Arnt
708b60e50e - Added support for KaOS, a lean KDE centric Linux distro;
- Added Chinese (Taiwan) and Malay translations.
2013-11-13 23:05:29 -02:00
Alexandre Arnt
afca94762e Copied octopi icon also to another gnome folder. 2013-11-03 03:24:27 -02:00
Alexandre Arnt
b9be74eaf2 - Fixed a typo in CHANGELOG. 2013-11-02 09:35:38 -02:00
Alexandre Arnt
5a3209dcc7 - Updated translations. 2013-11-01 20:57:22 -02:00
Alexandre Arnt
f3f8041166 - Added more checks in getPackageGroups() code. 2013-10-23 02:08:44 -02:00
Alexandre Arnt
80ee334925 - Added hungarian translation (thanks to lajos - Lajos Pasztor);
- Updated some translations.
2013-10-23 02:00:23 -02:00
Alexandre Arnt
9cbc121992 - Added serbian translation (thanks to Milena Petrović). 2013-10-28 23:42:20 -02:00
Alexandre Arnt
eba451cf3a - Added an About Dialog to Octopi Notifier. 2013-10-28 10:08:17 -02:00
Alexandre Arnt
c585108118 - Code cleaning. 2013-10-27 23:01:48 -02:00
Alexandre Arnt
afb59dc6c2 - Bugfix in notifier code logic. 2013-10-27 22:01:05 -02:00
Alexandre Arnt
fcd73beae4 - Removed "dev" string from About Dialog. 2013-10-20 18:51:37 -02:00
Alexandre Arnt
169515a8c4 - Updated translations. 2013-10-20 18:03:23 -02:00
Alexandre Arnt
1fd0097963 - Added swedish translation (thanks to riiga);
- Updated other translations.
2013-10-22 22:28:08 -02:00
Alexandre Arnt
ba51e3f653 - Added portuguese (Portugal) translation;
- Updated translations.
2013-10-20 05:34:51 -02:00
Alexandre Arnt
ed594216cc - Added new method _rebuildPackageList, to fix a bug in
buildPackagesFromGroupList refresh.
2013-10-20 02:33:09 -02:00
Alexandre Arnt
78b16a0743 - Updated fr and nl translations. 2013-10-20 17:46:58 -02:00
Alexandre Arnt
dc91892634 - Updated pt_BR translation. 2013-10-20 15:52:12 -02:00
Alexandre Arnt
357c1212c1 - Added support to remove Pacman's transaction lock file;
- Added new strings to transalate;
- Couple of code cleanings and fixes.
2013-10-20 15:39:36 -02:00
Alexandre Arnt
1113611f2e - Xterm is now an official Octopi dependency. 2013-10-19 22:47:33 -03:00
Alexandre Arnt
31f7121901 - BugFix: Disable pacman and yaourt status bar buttons while in a
transaction.
2013-10-19 22:42:53 -03:00
Alexandre Arnt
c3d09a7095 - Added new english_GB translation (thanks to jonathon -J Fernyhough). 2013-10-19 20:28:05 -03:00
Alexandre Arnt
97b90cb7cc - Updated Uzbek translation. 2013-10-19 17:58:07 -03:00
Alexandre Arnt
9f4e80edd5 - Bug fixes in multiselectiondialog code. 2013-10-19 17:04:54 -03:00
Alexandre Arnt
2974bf900b - BugFixes in graphical remove code. 2013-10-19 14:59:39 -03:00
Alexandre Arnt
80b2a660cd - BugFixes in install and remove into transaction code. 2013-10-19 14:27:25 -03:00
Alexandre Arnt
01d4323f02 - BugFixes in remove and insert into transaction code. 2013-10-19 11:30:31 -03:00
Alexandre Arnt
957f907387 - Now when removing a package with dependencies, Octopi lets users
choose which one they want to remove.
2013-10-19 00:33:33 -03:00
Alexandre Arnt
e727a17ed9 - Bring back the option to do a graphical system upgrade;
- Updated bulgarian translation.
2013-10-17 21:10:04 -03:00
Alexandre Arnt
380b952606 - Bug fix in optional deps selection code. 2013-10-15 00:10:27 -03:00
Alexandre Arnt
8c9b422b69 - Added a checkbutton to the optional deps dialog. 2013-10-14 23:57:54 -03:00
Alexandre Arnt
bcd269b931 - Updated bulgarian and turkish translations;
- Updated MultiSelectionDialog code.
2013-10-14 00:20:36 -03:00
Alexandre Arnt
f4dd17fd4b Added "Optional Deps" to package menu to install the available
optional dependencies of the selected package.
2013-10-13 23:08:39 -03:00
Alexandre Arnt
c72810d69a - Using "Manjaro" style in all desktops. 2013-10-12 23:00:27 -03:00
Alexandre Arnt
983a5d36a1 - Updated finish translation;
- BugFix: Use "yaourt -S aur/pkgname" to install yaourt packages (thanks
to ringo32).
2013-10-12 22:44:30 -03:00
Alexandre Arnt
72036d1f43 - Updated arabic and indonesian translations 2013-10-05 14:47:10 -03:00
Alexandre Arnt
4b58718da0 - Added support for pkgfile to view uninstalled package file list while
in ArchLinux/ArchBang (thanks to Damián Nohales);
- Updated some translations and files.
2013-10-03 21:55:08 -03:00
Alexandre Arnt
01a0cf6686 Merge pull request #7 from eagleoneraptor/pkgfile
Add pkgfile support for listing noninstalled packages content
2013-10-03 16:44:47 -07:00
Damián Nohales
183681a4d1 Add pkgfile support for listing noninstalled packages content 2013-09-30 16:10:16 -03:00
Alexandre Arnt
d64446fe7d - Code cleanings in mainwindow.cpp code. 2013-09-28 09:54:09 -03:00
Alexandre Arnt
c9d34d5736 - BugFix: do not let outputOutdatedYaourtPackageList go on if we are
executing a transaction;
- Added xterm as optional dependency for octopi.
2013-09-27 22:46:45 -03:00
Alexandre Arnt
69ef11cae2 Merge branch 'master' of https://github.com/aarnt/octopi 2013-09-27 21:59:52 -03:00
Alexandre Arnt
ad5c395e30 - Changed some waitForFinished(-1) to the default 30 seconds version. 2013-09-27 21:59:19 -03:00
Alexandre Arnt
840bafb136 - Updated el and nb translations;
- Updated CHANGELOG file.
2013-09-20 01:11:34 -03:00
Philip
1613eca16b fix icon in octopi.desktop 2013-09-22 10:10:01 +02:00
Alexandre Arnt
4587132a3e Revert "- BugFix in notifier code."
This reverts commit 583a69195b.
2013-09-19 23:09:50 -03:00
Alexandre Arnt
583a69195b - BugFix in notifier code. 2013-09-19 22:58:58 -03:00
Alexandre Arnt
013669d2dc - Test action before setting it. 2013-09-18 23:56:03 -03:00
Alexandre Arnt
64e9346c8f - Now "Get Latest Distro News" doesn't freeze the interface;
- Refactorings in some methods.
2013-09-18 23:17:16 -03:00
Alexandre Arnt
be91726560 - Changed octopi main icon to octopi-green.png in PKGBUILD and
octopi.desktop;
- Added menu "Octopi" and "System Upgrade" in octopi-notifier;
- Bumped version number to 0.3.
2013-09-17 21:47:28 -03:00
Alexandre Arnt
a021e2d7fb - Now octopi-notifier opens only the transaction dialog if Octopi is not
running and user requests a system upgrade.
2013-09-16 23:23:09 -03:00
Alexandre Arnt
dcb42e6c42 - Added new octopi icons to the PKGBUILD;
- When there are pacman updates, start "notify-send" with red octopi
icon.
2013-09-16 21:11:15 -03:00
Alexandre Arnt
0139692edb - Added number of outdated packages text beside the proper icon at
statusbar.
2013-09-15 22:06:34 -03:00
Alexandre Arnt
8671c8f504 - BugFix: minor bugfixes in statusbar notification buttons. 2013-09-01 12:13:39 -03:00
Alexandre Arnt
36d5a5b3db - Updated translations;
- Show Yaourt packages as outdated in default package list;
- Now it's possible to upgrade Yaourt packages even outside Yaourt
group;
- Now the yellow octopi icon means there are outdated yaourt packages;
- Added a new notification for outdated packages on statusbar.
2013-09-15 15:08:10 -03:00
Alexandre Arnt
20a81da5cd - Show Yaourt packages as outdated in default package list;
- Updated CHANGELOG.
2013-09-12 23:22:01 -03:00
Manjaro Linux
7eb6773fbd Merge pull request #5 from anselmolsm/tooltip
Import patch by Anesl Molsm - Notifier: clear tooltip if no update is available
2013-09-11 22:20:26 -07:00
Anselmo L. S. Melo
209799ea95 Notifier: clear tooltip if no update is available 2013-09-11 23:14:21 -03:00
Alexandre Arnt
5a0fc235a0 - Now it's possible to upgrade Yaourt packages even outside Yaourt
group.
2013-09-11 22:41:58 -03:00
Alexandre Arnt
654cd5f7dc Updated CHANGELOG file. 2013-09-10 23:22:46 -03:00
Alexandre Arnt
67f8a689af - BugFix: Octopi was acting as in Openbox while in RazorQt Desktop. 2013-09-10 22:58:10 -03:00
Alexandre Arnt
a365bcf978 - BugFix: Use -Ss option while searching for yaourt packages;
- BugFix: Don't show package names in yaourt package descriptions.
2013-09-09 22:08:59 -03:00
Alexandre Arnt
9efe5e82e7 - Updated CHANGELOG file. 2013-09-08 00:02:36 -03:00
Alexandre Arnt
d1cb7bb7aa - BugFix: No need to refresh package list after a cache clean;
- Code cleanings in StrConstants class.
2013-09-08 00:00:26 -03:00
Alexandre Arnt
7884078f87 - Code cleaning. 2013-09-02 05:50:20 -03:00
Alexandre Arnt
4c78b0d33a - BugFix: Position of search icon in searchedit sometimes was
wrong;
- BugFix: Some actions did not get disabled while executing a
transaction;
- Updated ca, da, he and ro translations;
- Updated CHANGELOG file.
2013-09-02 05:47:16 -03:00
Alexandre Arnt
df2eb70601 Updated sr@latin translation. 2013-09-01 16:00:29 -03:00
Alexandre Arnt
e597daf289 Updated fi and de translations. 2013-09-01 15:04:29 -03:00
Alexandre Arnt
a574c1bf74 - Updated es_ES, fr_FR, it and vi translations;
- Updated CHANGELOG file.
2013-09-01 10:02:18 -03:00
Alexandre Arnt
9105033cad - Bugfixes in notifier systray menu while in system upgrade mode. 2013-08-24 12:51:37 -03:00
Alexandre Arnt
b78fe80e6f - Added new source string;
- Updated pt_BR translation.
2013-08-16 08:03:47 -03:00
Alexandre Arnt
9c8ecdd814 - Updated greek translation;
- Updated CHANGELOG file.
2013-08-16 04:27:07 -03:00
Alexandre Arnt
477e3a0a30 - BugFix: Outdated/Newer package code test. 2013-08-16 03:24:03 -03:00
Alexandre Arnt
6750b2880f - Updated he, vi and fr_FR translations;
- Updated CHANGELOG file.
2013-08-16 02:38:54 -03:00
Alexandre Arnt
0f17151cd1 Merge branch 'master' of https://github.com/aarnt/octopi 2013-08-29 23:07:05 -03:00
Alexandre Arnt
074915b8cb - Updated pt_BR translation;
- Updated runCommandInTerminalAsNormalUser logic for KDE.
2013-08-29 23:06:56 -03:00
Alexandre Arnt
b43a39084c - Updated pt_BR translation;
- Updated runCommandInTerminalAsNormalUser logic for KDE.
2013-08-29 23:04:46 -03:00
Alexandre Arnt
33d50107ac - Added "Required By" and "Optional For" in Info tab. 2013-08-29 22:43:03 -03:00
Alexandre Arnt
56146fa77c - Added icon and logic for newer than repository installed packages;
- Added new source string;
- Updated CHANGELOG;
- Updated pt_BR translation.
2013-08-29 21:54:16 -03:00
Alexandre Arnt
2b8287fa3e - BugFix: konsole was not working with yaourt, changed to xterm;
- Refactorings in style code.
2013-08-28 22:43:58 -03:00
Alexandre Arnt
17f390ed9c - Code cleanings;
- Added spanish (Latin America), thanks to CostGranda (Cost Granda);
- Updated CHANGELOG, PKGBUILD and TRANSLATIONS files.
2013-08-27 22:20:15 -03:00
Alexandre Arnt
2cda92a291 Merge branch 'master' of https://github.com/aarnt/octopi 2013-08-24 14:44:01 -03:00
Alexandre Arnt
2db3fbab65 - Updated CHANGELOG file;
- BugFix: Open root terminal was not testing for gksu/kdesu.
2013-08-24 14:43:26 -03:00
Alexandre Arnt
bb36311dee - Updated CHANGELOG file. 2013-08-24 01:24:08 -03:00
Alexandre Arnt
ec34f2e310 - BugFix: Open root terminal with xterm, code;
- BugFix: Unicode errors on empty pkg descriptions.
2013-08-24 01:04:02 -03:00
Alexandre Arnt
63560a25d4 - Updated CHANGELOG file. 2013-08-23 23:32:05 -03:00
Alexandre Arnt
c36dbd80a4 - Added support for Xterm terminal. 2013-08-23 23:31:05 -03:00
Alexandre Arnt
2083e0ef92 Merge branch 'master' of https://github.com/aarnt/octopi 2013-08-16 02:15:53 -03:00
Alexandre Arnt
a7c2dc19e7 - Code cleanup;
- Updated CHANGELOG file.
2013-08-16 02:15:36 -03:00
Alexandre Arnt
0a46f47d53 - Code cleanup. 2013-08-16 02:03:00 -03:00
Alexandre Arnt
8b81a019b2 - Updated CHANGELOG and TRANSLATIONS files;
- Added Vietnamese translation, thanks to ppanhh (Anh Phan);
- BugFix: Now Octopi honors "ignorePkg" option (from /etc/pacman.conf).
2013-08-16 01:59:50 -03:00
Alexandre Arnt
f96c77b4dd - Updated CHANGELOG file. 2013-08-22 21:57:23 -03:00
Alexandre Arnt
fceed3f9e6 - BugFix: english translation source string;
- Updated ALL translations;
- Added finnish translation;
- Updated TRANSLATIONS file;
- Updated THANKS file;
- Commemted some printouts.
2013-08-21 22:33:29 -03:00
Alexandre Arnt
d12cc4c83e - Another try... 2013-08-21 19:57:07 -03:00
Alexandre Arnt
d846f0cb25 Another test for Yaourt mode. 2013-08-21 19:12:36 -03:00
Alexandre Arnt
f0291a164c - Another try to fix Yaourt mode. 2013-08-20 23:35:55 -03:00
Alexandre Arnt
78e5eb7d1d - Another try to fix the Yaourt mode.
- Updated THANKS file.
2013-08-20 23:16:05 -03:00
Alexandre Arnt
b7d31f060d - A test... 2013-08-20 19:55:18 -03:00
Alexandre Arnt
26a69191a0 Merge branch 'master' of https://github.com/aarnt/octopi 2013-08-20 19:08:16 -03:00
Alexandre Arnt
c67efd002c - BugFix: Start timer only when process has started
(processwrapper.cpp).
2013-08-20 19:07:40 -03:00
Alexandre Arnt
58251a3bd5 - BugFix: Running Yaourt as root user was not good;
- Refactorings needed for the bugfix above.
2013-08-19 21:53:48 -03:00
Alexandre Arnt
6d063e6f7f - Refactorings and bugfixes in Yaourt code. 2013-08-18 22:01:58 -03:00
Alexandre Arnt
3aaf4a9970 - BugFix in Cinnamon support (thanks to dsngjoe);
- Updated THANKS file.
2013-08-18 16:49:19 -03:00
Alexandre Arnt
fedf3b3209 - Added another contributor :-) 2013-08-18 12:28:06 -03:00
Alexandre Arnt
b0753af034 - Updated a bunch of related files. 2013-08-18 02:10:49 -03:00
Alexandre Arnt
ab4a5e13fa - Added support for multiple selection while in Yaourt mode;
- Couple of code refactorings.
2013-08-18 02:01:02 -03:00
Alexandre Arnt
f43d31877f - Code cleaning. 2013-08-17 11:54:25 -03:00
Alexandre Arnt
cf061f2622 - Added Uzbek translation - thanks to ualmasov (Umidjon Almasov) 2013-08-17 00:06:01 -03:00
Alexandre Arnt
cd6e031a34 - Updated CHANGELOG file. 2013-08-16 21:22:17 -03:00
Alexandre Arnt
542a206d01 - BugFix: We have to disable/enable the install local package function
when Octopi is executing a transaction.
2013-08-16 21:07:43 -03:00
Alexandre Arnt
f97448429e - Added russian translation (thanks to macbet and ualmasov);
- Optimized some testing code;
- Updated TRANSLATIONS file.
2013-08-15 23:39:28 -03:00
Alexandre Arnt
95077c712b - Octopi tooltip is no longer used in notifier;
- Doesn't call refreshDistroNews when in sysUpgrade.
2013-08-15 22:20:05 -03:00
Alexandre Arnt
7aa6104e14 - Added processwrapper.cpp to notifier's project;
- Updated CHANGELOG file.
2013-08-14 23:04:40 -03:00
Alexandre Arnt
60902de817 - Modified the link colors when not in Manjaro;
- Removed unused help_en_US.html file.
2013-08-14 22:13:25 -03:00
Alexandre Arnt
1c851e1817 - Code cleanings. 2013-08-14 21:35:28 -03:00
Alexandre Arnt
161d1cb6c9 - BugFix: When in yaourt mode, never show outdated files at statusbar;
- BugFix: english source language had a bug string;
- Updated all translations to fix the source bug;
- Reverted the hiden icon in octopi-notifier;
- Added comments to wmhelper.cpp.
2013-08-13 22:30:04 -03:00
Alexandre Arnt
3b90e3e6a2 - BugFix: When not in Manjaro and KDE, let's put a cleanlooks style in
octopi notifier;
- Hide notifier when there's no more updates available.
2013-08-11 05:55:49 -03:00
Alexandre Arnt
86497ea2c8 - Updated Dutch translation. 2013-08-11 03:55:49 -03:00
Alexandre Arnt
2b8ed46a59 - BugFix: Locale bug in UnixCommand code (thanks to Philip Mueller's
patch);
- Added dutch translation (thanks to Jasper van der Marel).
2013-08-11 03:02:28 -03:00
Alexandre Arnt
4aef1245c9 - Updated polish translation;
- BugFix: When there are issues with pacman upgrade we show them in
Output tab.
2013-08-10 13:59:44 -03:00
Alexandre Arnt
e37cb11343 - BugFix: In doInstallYaourtPackage(), when the user selected to show
only installed packages, Octopi did not honor user selection.
2013-08-10 00:25:06 -03:00
Alexandre Arnt
26047e92a5 - Updated CHANGELOG file. 2013-08-09 19:55:35 -03:00
Alexandre Arnt
22586db454 - BugFix: In notifier, call sysupgrade only when Octopi's icon is red
and angry :-)
2013-08-09 19:40:34 -03:00
Alexandre Arnt
3e224391fe - Updated resources.qrc file. 2013-08-09 18:08:54 -03:00
Alexandre Arnt
beb6f9a114 - Updated some translations;
- Added Servian latin translation (thanks to GameBoyT)
- Updated TRANSLATIONS file.
2013-08-09 18:08:05 -03:00
Alexandre Arnt
2a84d8d728 BugFix: system upgrade was not being called by the notifier in Manjaro;
Updated system upgrade code, including a new qt singleapp message;
Updated italian translation.
2013-08-04 00:38:00 -03:00
Alexandre Arnt
bed9898498 - BugFix in retrieveDistroNews code. 2013-08-03 20:01:04 -03:00
Alexandre Arnt
4aa9a89ed5 Merge branch 'master' of https://github.com/aarnt/octopi 2013-08-03 18:41:26 -03:00
Alexandre Arnt
181257ab9e - Updated catalan and turkish translations;
- Small bugfixes in QProcess preparation code;
- Code cleaning in wmhelper.cpp.
- BugFix: code to search for yaourt.
2013-08-03 18:40:30 -03:00
Alexandre Arnt
680432877d - Updated catalan and turkish translations;
- Small bugfixes in QProcess preparation code;
- Code cleaning in wmhelper.cpp.
2013-08-03 11:49:23 -03:00
Alexandre Arnt
4080d95306 - BugFix: external terminals did not use translations;
- Added Cinnamon DM support;
- Modified PKGBUILD (thanks to Philip Mueller) to split octopi and
notifier;
- Updated lots of translations.
2013-08-01 23:22:41 -03:00
Alexandre Arnt
d92a78c563 - Added "install local package option";
- Updated english and brazilian translations.
2013-07-29 21:20:20 -03:00
Alexandre Arnt
64618001f4 - BugFix: progress bar of the package list building didn't show 100%;
- Octopi now installs local packages with pacman -U command.
2013-07-28 22:53:51 -03:00
Alexandre Arnt
e8089a9f7d - BugFix in octopi-notifier where it called notify-send several times;
- Added norwegian bokmål translation (thanks to viking60).
2013-07-26 22:25:30 -03:00
Alexandre Arnt
6821d6dca4 - BugFix: Important fix in GTKStyle code. 2013-07-25 22:54:12 -03:00
Alexandre Arnt
f266b18285 - Some small refactorings. 2013-07-25 22:25:19 -03:00
Alexandre Arnt
b1e966b6b6 - BugFix in notify-send code. 2013-07-23 20:39:46 -03:00
Alexandre Arnt
e3d8e6fe3f - Updated notify-send code. 2013-07-24 22:23:11 -03:00
Alexandre Arnt
4fa2a65db2 - Updated CHANGELOG file. 2013-07-24 21:49:48 -03:00
Alexandre Arnt
582a4ab7e4 - BugFix: refresh package list after a syncdb if the notifier is
running;
- Updated arabian translation.
2013-07-24 21:46:56 -03:00
Alexandre Arnt
f0c17ae27a - Added octopi_lt.ts file. 2013-07-23 19:47:16 -03:00
Alexandre Arnt
db74213976 - Updated CHANGELOG and TRANSLATIONS files. 2013-07-23 19:46:04 -03:00
Alexandre Arnt
f55cca4827 - Added Lithuanian translation. 2013-07-23 19:44:21 -03:00
Alexandre Arnt
0b53e96a71 BugFix: A missing test when using GTK style. 2013-07-23 19:32:18 -03:00
Alexandre Arnt
f477ba4cf8 Merge branch 'master' of https://github.com/aarnt/octopi 2013-07-22 23:12:23 -03:00
Alexandre Arnt
a24a187fe0 - Updated CHANGELOG file. 2013-07-23 00:23:21 -03:00
Alexandre Arnt
3da1929c70 - Changed octopi-notifier timer to 1 hour.
- BugFix in octopi-notifier's notify-send code.
2013-07-23 00:09:43 -03:00
Alexandre Arnt
f5e154d24a - BugFix: When running in Manjaro and not in KDE, Octopi uses GtkStyle. 2013-07-22 23:11:49 -03:00
Alexandre Arnt
54bde33675 - Added "notify-send" support to octopi-notifier. 2013-07-22 22:58:06 -03:00
Alexandre Arnt
a771c37ca6 - BugFix in gtk style code. 2013-07-22 22:09:59 -03:00
Alexandre Arnt
60c3b5fecb - Bugfix in xfce theme. 2013-07-21 22:49:37 -03:00
Alexandre Arnt
6d32f8ed06 - BUGFIX: setAlternatingRowColors(true) only if running in Manjaro and
not in KDE.
2013-07-21 22:35:40 -03:00
Alexandre Arnt
40c53d073b - Update: When the user closes notifier and Octopi was running, tries to
close it too;
- Removed styles from Manjaro theme, so it is almost GTK native.
2013-07-21 22:31:17 -03:00
Alexandre Arnt
31324ba240 - Updated TRANSLATIONS file. 2013-07-21 20:43:43 -03:00
Alexandre Arnt
c27e34da2c - Added hebrew translation (thanks to GenghisKhan) 2013-07-21 20:42:26 -03:00
Alexandre Arnt
75a2aba102 Merge branch 'master' of https://github.com/aarnt/octopi 2013-07-21 20:31:16 -03:00
Alexandre Arnt
cdcf75f60f - Now the notifier hides/shows octopi when clicked;
- Reworked logic of qtsingleapplication code;
- Some refactorings in some methods.
2013-07-21 20:30:15 -03:00
Alexandre Arnt
8f0146812b BugFix: call a QApplication::restoreOverrideCursor() before a
systemUpgrade inside buildPackageList code.
2013-07-20 23:49:57 -03:00
Alexandre Arnt
e3e709f69b - Updated PKGBUILD (thanks to Philm from Manjaro);
- BugFix in transaction code when Octopi starts straight in sysupgrade
mode.
2013-07-20 00:27:53 -03:00
Alexandre Arnt
0db39e04dc - Added a desktop file to the octopi-notifier util. 2013-07-20 00:02:49 -03:00
Alexandre Arnt
eb77f8cbdd - BugFix in sysupgrade code. 2013-07-20 22:31:30 -03:00
Alexandre Arnt
a471490e6e - Created octopi-notifier project;
- Lots of refactorings to cope with this;
- Bumped version number to 0.2.
2013-07-20 22:10:06 -03:00
Alexandre Arnt
99e04027a6 - Bugfix in style guessing code. 2013-07-19 23:44:02 -03:00
Alexandre Arnt
52b6ab1aac - Bugfixes in style guessing code. 2013-07-20 14:08:21 -03:00
Alexandre Arnt
f623438072 - Updated CHANGELOG. 2013-07-20 14:03:08 -03:00
Alexandre Arnt
57e906c403 - Bugfixes in style guessing code. 2013-07-20 13:59:06 -03:00
Alexandre Arnt
3e46942841 - Octopi now defaults to gtk style while in Manjaro, plastique in KDE
and CleanLooks elsewhere;
- Bugfixes in searchlineedit.cpp code.
2013-07-20 12:21:54 -03:00
Alexandre Arnt
ee5d7640d2 - Updated transaction code to remove a message. 2013-07-14 22:37:13 -03:00
Alexandre Arnt
d8d367986e - Added copyright header in globals.* files. 2013-07-14 16:55:05 -03:00
Alexandre Arnt
343c80486e - Created a parameter in buildPackageList method, indicating whether to
run it non-blocking (default) or not.
2013-07-14 15:54:57 -03:00
Alexandre Arnt
a8a486eb58 BugFix: when user cancelled a sysupgrade transaction inside a terminal,
the package actions remained disabled;
Updated CHANGELOG.
2013-07-14 14:53:02 -03:00
Alexandre Arnt
1cb131bff3 - Updated CHANGELOG and PKGBUILD files;
- Bumped version number to 0.1.9.1.
2013-07-14 12:10:58 -03:00
Alexandre Arnt
b0b2a5f1f8 - Missed files in the last commit... 2013-07-14 11:47:58 -03:00
Alexandre Arnt
bee7d84536 - Changed important logic in transaction, concerning multithreaded code.
- Added globals.cpp/.h files to group global future watchers.
- A couple of refactorings.
2013-07-14 11:47:19 -03:00
Alexandre Arnt
cb34e6dfef - Improved yaourt support.
- Bugfixes and refactorings.
2013-07-09 21:44:25 -03:00
Alexandre Arnt
de00f0739d - Lots of bugfixes related with yaourt support. 2013-07-07 22:00:41 -03:00
Alexandre Arnt
d9385ef82e - BugFix: After a yaourt transaction the package list was not being
refreshed.
2013-07-07 11:39:20 -03:00
Alexandre Arnt
692bc3eb3c - BugFix:: there was a nasty bug in getAvailablePackage code! 2013-07-07 11:05:29 -03:00
Alexandre Arnt
1393e4dcef - BugFix: ProgressBar code refactorings. 2013-07-07 00:10:26 -03:00
Alexandre Arnt
a3020a5136 - Bugfixes in package list refresh code. 2013-07-06 23:16:14 -03:00
Alexandre Arnt
baaf637a41 - Lots of refactorings to make package build code less blocking. 2013-07-06 22:41:24 -03:00
Alexandre Arnt
07c3339975 - Implemented a method to delete QStandardItem models;
- Refactorings in package list refreshing code.
2013-07-05 22:30:13 -03:00
Alexandre Arnt
29e9970d68 - Refactoring in _cloneModelPackages method. 2013-07-05 21:32:54 -03:00
Alexandre Arnt
abee17325d - Changed comment... 2013-07-05 20:47:14 -03:00
Alexandre Arnt
5cfb2f2a43 - Removes Yes button from the System Upgrade transaction dialog. 2013-07-05 19:21:35 -03:00
Alexandre Arnt
56471fb574 - Updated CHANGELOG and PKGBUILD files. 2013-07-05 18:53:45 -03:00
Alexandre Arnt
f259758f42 - BugFix: only insert Yaourt group if the user has the utility
installed.
2013-07-05 18:50:33 -03:00
Alexandre Arnt
c0e3ac8c60 - Added ctrl+shift+Y shortcut to go to the yaourt mode;
- Cleanup some unused code;
- Bugfix when returning from a yaourt transaction;
- Bugfix when yaourt searches return 0 entries.
2013-07-04 23:00:58 -03:00
Alexandre Arnt
6ddb4c98d6 - Updated catalan, danish and polish translations;
- Bunch of refactorings and code cleaning;
- Added support for yaourt;
- Bumped version number to 0.1.9.
2013-07-04 22:14:49 -03:00
Alexandre Arnt
fb67cd2b86 - Conflict issues in git. 2013-06-28 22:13:42 -03:00
Alexandre Arnt
04251cd9f9 - BugFix: We dont notify-sync while in a transaction! 2013-06-28 22:05:50 -03:00
Alexandre Arnt
d5ae2e0617 - Updated PKGBUILD and pacmanhelper service file to install binary at
/usr/lib.
2013-06-16 13:40:53 -03:00
Alexandre Arnt
f6fecd4df2 - Updated bulgarian translation. 2013-06-16 06:19:09 -03:00
Alexandre Arnt
38c12ec313 - Updated the way Octopi launches the PacmanHelper timer. 2013-06-16 02:03:30 -03:00
Alexandre Arnt
26813c7178 - Bugfix in buildPackageList code.
- Updated german and greek translations.
2013-06-15 19:16:08 -03:00
Alexandre Arnt
0ff2a6d5d0 - Changed notifier code to run "pacman -Syy". 2013-06-15 12:06:06 -03:00
Alexandre Arnt
401f0a5a42 - Changed notifier interval to 1 hour. 2013-06-15 11:55:26 -03:00
Alexandre Arnt
4334283cc6 - Let us count Octopi in the m_numberOfInstalledPackages... 2013-06-15 11:25:11 -03:00
Alexandre Arnt
1947269b11 - Updated romanian translation. 2013-06-15 09:46:35 -03:00
Alexandre Arnt
6be391371d - Updated CHANGELOG file. 2013-06-15 06:47:06 -03:00
Alexandre Arnt
b69baae4b8 - Added Czech translation (thanks to fri)! 2013-06-15 06:31:37 -03:00
Alexandre Arnt
47c0e647cc - Updated CHANGELOG file. 2013-06-15 05:57:22 -03:00
Alexandre Arnt
aa09b47c3a - Improved support for ArchBang Linux. 2013-06-15 05:43:05 -03:00
Alexandre Arnt
5f69d430a3 - Added a README file with instructions on how to
create PacmanHelper's QDbusAdaptor.
2013-06-15 02:07:20 -03:00
Alexandre Arnt
d87a0e2ce3 - Added support to ArchBang Linux. 2013-06-14 18:46:21 -03:00
Alexandre Arnt
4761671cac - When there are updated distro news and the mainwindow is hidden, let
it be shown!
2013-06-09 23:45:10 -03:00
Alexandre Arnt
e23fd407e7 - Cut package description tooltips with size greater than 120 chars. 2013-06-09 19:33:02 -03:00
Alexandre Arnt
891d94a66a - Updated INSTALL instructions. 2013-06-09 18:40:32 -03:00
Alexandre Arnt
371216bbe6 - Subtracts octopi from the package and outdated lists ;-) 2013-06-09 15:35:33 -03:00
Alexandre Arnt
66aa26788a - Updated some translations;
- BugFix in refreshSystemTrayIcon code.
2013-06-09 13:47:55 -03:00
Alexandre Arnt
0ebcb5ac2c - Updated french and turkish translations. 2013-06-06 21:39:40 -03:00
Alexandre Arnt
13f7240b01 - Updated CHANGELOG. 2013-06-05 23:22:42 -03:00
Alexandre Arnt
160f6b184e - Bugfix in refreshSystemTrayIcon code. 2013-06-05 23:14:19 -03:00
Alexandre Arnt
f724249202 - Updated translations (pt_BR and tr_TR). 2013-06-05 21:57:23 -03:00
Alexandre Arnt
078e555de3 - Adjusted PKGBUILD file;
- Added refreshDistroNews() to afterPacmanHelperSyncDatabase code.
2013-06-04 23:13:08 -03:00
Alexandre Arnt
eeba5e4a07 - Added notifier support! 2013-06-03 23:38:46 -03:00
Alexandre Arnt
1c2785c056 - Code cleaning. 2013-05-29 20:47:05 -03:00
736 changed files with 202234 additions and 11489 deletions

33
.gitignore vendored Normal file
View File

@@ -0,0 +1,33 @@
*.user
.qmake.stash
.qtc_clangd/**
Makefile
bin/**
build/**
build_dir/**
helper/*.o
helper/.qtc_clangd/**
helper/moc*.*
helper/octphelper
cachecleaner/bin/**
cachecleaner/build/**
cachecleaner/.qtc_clangd/**
notifier/bin/**
notifier/build/**
notifier/.qtc_clangd/**
notifier/.qtc/**
notifier/.cmake/**
notifier/CMakeCache*
notifier/CMakeFiles*
notifier/qtcsettings.cmake
octopi.pro.user
qrc_resources.cpp
repoeditor/.qtc_clangd/**
repoeditor/bin/**
repoeditor/build/**
sudo/*.o
sudo/moc*.*
sudo/octopi-sudo
sudo/qrc*.cpp
sudo/ui_pass*.h
sudo/.qtc_clangd

11
.tx/config Normal file
View File

@@ -0,0 +1,11 @@
[main]
host = https://www.transifex.com
[o:arnt:p:octopi:r:octopi]
file_filter = resources/translations/octopi_<lang>.ts
source_file = resources/translations/octopi_en.ts
source_lang = en
type = QT
replace_edited_strings = false
keep_translations = false

665
CHANGELOG
View File

@@ -1,4 +1,641 @@
0.1.7.3
0.19 (dev)
BugFix: Pressing F11 to maximize bottom panel crashed Octopi if Info tab was selected.
BugFix: Octopi crashed after using AUR/KCP tool and clicking on a package anchor
in Output tab.
BugFix: Optional deps dialog had a column header named "3" instead of "Repository".
BugFix: Some outdated AUR pkgs were not showing on notifier (thanks to urbenlegend).
BugFix: There was a method called more than once every time distro news was checked.
Add the option to make the whole interface text less condensed.
Add the option to show/hide "Repository" and "Download Size" columns in package list.
Add Repository field in Info tab.
Make "Search for outdated AUR packages" a notifier only option.
Enable Check updates and System upgrade tool buttons in AUR mode.
Show current version of the packages on Notifier's System Upgrade dialog
(thanks to valchx's code).
Added chinese description for the application name in desktop file.
Updated translations.
0.18.1 (2025-09-29)
BugFix: French translation was not working properly (thanks to roxfr).
BugFix: Yay searches with version 12.5.2 crashed Octopi (thanks to nije-to-sve).
BugFix: Search for BASH also in "/bin".
BugFix: Force use of BASH shell was not working (thanks to UnsaltedScholar).
BugFix: List of outdated KCP packages was not working in KaOS.
BugFix: Under some conditions Octopi could crash due to shared memory access failures.
Updated translations.
0.18.0 (2025-09-20)
BugFix: The act of moving the mouse over the package list was triggering many
"pacman -Si" executions (thanks to RAZUMNO).
BugFix: Notifier did not fetch updates for the first time when using "once a day".
BugFix: qt-sudo now respects user locale settings (thanks to D10RUS).
BugFix: Use better way to detect if user is running the tools from the right place.
BugFix: Select Help tab when Octopi runs for the first time.
BugFix: Make Actions tab visible when a package is selected for insertion/removal.
BugFix: Use system theme folder icon in Files tab.
BugFix: Package list refresh was not running after a group install/removal.
BugFix: ILoveCandy option was not working 100% in parser.
Search option selected by the user is saved on close.
Added support for garuda-update command when running in Garuda Linux.
Added support for a user specified backup shell script that needs to be placed at
"/usr/lib/octopi/pre-system-upgrade.sh" and executes before the system upgrades.
Added support for pacman.conf's IgnorePkg option through "Add to Ignored" and
"Remove from Ignored" actions from the context menu in the package list.
Added View/Ignored menu option.
Added support for Plus and Minus keys to add and remove packages from the system.
Added "Get Latest distro news" menu item to the News tab context menu.
Added Apply and Cancel buttons also in the Actions tab.
Added "Enable package tooltips" option, so users can disable the feature when needed.
Added "Force use of BASH shell" option to ensure compatibility when the user
uses another SHELL.
Added Tools/pacman-key option to refresh pacman gpg keys.
Modernization of Options dialog.
Updated translations.
0.17.0 (2025-02-18)
BugFix: Code for EndeavourOS news was incomplete (thanks to LegitGreenBoi).
BugFix: Help msg for newer packages was wrong because they're not installed.
Prefer Bash shell (/usr/bin/bash) when executing package commands.
Added "--editmenu" checkbox on Options dialog if you are using Yay tool.
Added option to always use the terminal when executing pacman actions.
Play a bell sound when the Terminal tab is asking for the user password.
Improvement: Let user choose which domain is pinged when checking for internet access
(if ping.archlinux.org is down).
Improvement: Show a "Collecting transaction data..." msg before presenting the transaction
dialog, as it can be quite slow on some systems (thanks to Valdir).
Updated translations.
0.16.2 (2024-06-17)
BugFix: Increased width of Terminal tab labels on Options dialog.
BugFix: Removed a debug msg when octopi was not being executed with "-d".
Updated translations.
0.16.1 (2024-06-09)
BugFix: Updated some LANG environment variables to C.UTF-8.
BugFix: Info/Files tabs were always empty if they were selected at octopi's start.
BugFix: Do not install notifier's desktop file in /etc/xdg/autostart.
BugFix: Could not remove packages when internet connection was down (thanks to Theluga).
Added shortcut key "Ctrl+Shift+U" to upgrade outdated AUR packages.
Arrow keys navegation refresh Info and Files tabs again.
Updated translations.
0.16.0 (2024-05-19)
BugFix: '--noeditmenu' is deprecated. Use '--editmenu=false' instead (thanks to rbaruccojr).
BugFix: Fixed silent error when pacman's database is locked (thanks to SloppyPuppy).
BugFix: Files tab expand all items by default.
BugFix: Updated translations.
Now using the unified qt-sudo project (https://github.com/aarnt/qt-sudo) for privilege escalation.
Default to Qt6 lib build (including qtermwidget6)
0.15.0 (2023-09-10)
BugFix: Invalidate Info/Files tabs when user is navigating packages using the keyboard.
BugFix: Better handle dependencies while staging packages for deletion.
BugFix: First yay-bin download now works again.
BugFix: Polished navigation on Info tab dependencies
BugFix: AUR passwords that contained a "+" char failed to login at aur.archlinux.org.
BugFix: When using the pacman backend, call "pacman -Qm" to fetch ALL foreign packages.
BugFix: Change install reason did not work with pacman backend.
Made the code Qt5/Qt6 compatible.
Using "pacman -Fl" to view contents of non installed packages (thanks to Zesko).
Added a Terminal tab to options dialog to config its colors and fonts.
Octopi-sudo code was synced to match project "lxqt-sudo" version 1.3.0.
0.14.0 (2022-10-05)
Added --overwrite="*" checkbox in AUR tab (Tools/Options) when using yay.
Octopi-sudo code was synced to match project "lxqt-sudo" version 1.1.0.
BugFix: Package search did not work correctly when query string contained a "+" sign.
BugFix: Info/Files tab refresh was duplicated.
BugFix: Disable (another try) Info/Files tab refresh while typing in Filter/Search
line edit.
0.13.0 (2022-03-30)
BugFix: editFile() caused a crash while in Mate desktop. Both "Open PKGBUILD"
and "Show PKGBUILD diff" options were affected.
BugFix: removed stylesheet from treeviews. It makes dark themes look better
(thanks to buckmelanoma).
BugFix: Pressing ENTER over an installed AUR pkg no longer sends it to the
install action treeview.
BugFix: Made Octopi compatible with aurweb 6.x version (view PKGBUILD,
diff PKGBUILD, vote, unvote and list voted AUR).
Added "Outdated" filter/option on menu "View".
Added a "-checkupdates" parameter to Notifier, so users can update the status
of an already running Octopi Notifier.
Added option to update selected outdated AUR pkgs directly from the main list.
0.12.0 (2021-11-06)
Added support for pacman 6.0 (thanks to class101)
Added support for Paru AUR tool.
Added support for opendoas tool (default).
Added support for Archcraft OS.
Added support for Garuda Linux distro.
Added support for Obarun Linux distro.
Actions tab shows a counter feedback for inserts (with a plus signal) and
removals (with a minus signal) and does not steal focus anymore.
Octopi-sudo code was synced to match project "lxqt-sudo" version 1.0.0.
BugFix: Initial database searches are executed after main interface is shown.
This improves UI feedback on older cpus.
BugFix: If there was only 1 result in AUR search, the pkg could not enter
the transaction with the right name.
BugFix: IgnorePkg pkgs are shown as outdated when using ALPM backend.
BugFix: If user went from AUR to normal search with a not found pkg the statusbar
counters would become invisible.
BugFix: If options dialog was called while both notifier and octopi were running,
Updates tab was not shown.
0.11.0 (2021-01-11)
Added support for CMake build system (thanks to Tereius).
Added support to build multiple foreign packages at once (they are first copied
to the Actions' tree view just like official packages).
Added "Open PKGBUILD" option to open the AUR PKGBUILD file in a text editor.
Added "Show PKGBUILD diff" option to show the differences between latest and previous
PKGBUILD files of the selected AUR package in a text editor.
Added "Install Date" at Info tab.
Added "Licenses", "Maintainer", "Depends On", "Make Deps", "Last Modified" and "Out-of-date"
fields at Info tab while in AUR mode.
Added option to display "Licenses", "Installed Size", "Build Date", "Install Date" and
"Install Reason" columns in the package list.
Added option to "Change Install Reason" of selected packages (Explicitly <-> As Dependency).
Added a faster refresh package list code after checking for updates.
Added "Build directory" option in AUR tab on options dialog, so users can change where
makepkg builds the source code.
Added support for '^' and '$' chars in AUR search
Added "Open news in a browser" option on right clicking the News tab.
Optional package dependencies are now installed with "--asdeps" parameter.
Octopi-sudo code was synced to match project "lxqt-sudo" version 0.16.0.
Updated PKGBUILD file following MatMoul's suggestion.
Removed unused speedup service.
Prevent users from running Octopi, Notifier and Cache Cleaner outside "/usr/bin" dir.
BugFix: Disable Info/Files tab refresh while typing in filter/search line edit.
BugFix: unset TMPDIR environment variable on every Octo tool startup
(to avoid "octopi-helper[aborted]: Couldn't attach to memory" errors).
BugFix: "total download size" showed the value 0 in Notifier if the database was not synched.
BugFix: Pressing ESC in repoeditor could ask if you wanted to save your changes even
if there were no changes made.
BugFix: Running Notifier within a DE session could lead to a "Suspicious execution method" error.
BugFix: If you tried to execute octopi after upgrading your system with notifier you got a
notifier crash and an octopi freeze (thanks to linuxer for pointing that out).
BugFix: Prevent icon changes in notifier when there were transaction errors.
BugFix: The list of targets to install were not showing ok in the transaction dialog.
BugFix: Restored support for command line parameters like "-sysupgrade-noconfirm" and "-style".
BugFix: Updated "-help" output text.
BugFix: Tab navigation improvements.
BugFix: Statusbar showed a number of packages when the list was empty (the previous value).
BugFix: Clicking on printed outdated packages in Output tab did not send to corresponding
package in the main list after a 'Check updates'.
BugFix: WM detection now uses "ps -aux".
0.10.0 (2020-07-19)
Added a built-in default priviledge escalation tool: "octopi-sudo" as a slightly modified version
of "lxqt-sudo" project (version 0.15.0). It's the only escalation tool supported!
Added option to vote/unvote for AUR packages using aur.archlinux.org login.
Added "pikaur" AUR tool support (thanks to ewilly).
Added "yay" AUR tool support.
Added option "--devel" in AUR tab to check for newer versions of dev packages.
Added option to download a temporary yay-bin to enable AUR.
Updated some UI icons and added an specific one for foreign non installed pkg.
Dropped support for external terminal applications. QTermWidget is mandatory now!
Print ".pacnew" file list summary after upgrade (if any).
Added Lumina desktop support.
RepoEditor now saves window size and position.
Added "copy" command to octopi's embedded terminal context menu.
Added option to enable/disable confirmation dialog in system upgrade.
Added option to enable/disable internet checking.
Renamed Transaction tab to Actions tab.
Added left click support on package icon in package list to launch context menu.
Added option to never check for package updates in Notifier.
Added tooltip "Upgrading..." while Notifier is upgrading the system.
Added "Info" option in package list context menu.
Added ArcoLinux, Artix Linux, CondresOS and EndeavourOS distro support.
Added support for sudo (and NOPASSWD) executing thru new octopi-helper subproject.
Added option to exit Octopi while a transaction is already running.
Added support for GNOME file manager/editor.
Added option for changing use of alternating row colors in package list.
Added a redesigned AUR tab in Options dialog.
Added option to change terminal's color scheme, font family and font size through ~/.config/octopi/octopi.conf.
Maximization of properties pane now hides tab bar.
BugFix: Many clazy/manual code enhancements merged from luis-pereira (from LXQt organization).
BugFix: AUR upgrades in notifier were not setting m_commandExecuting flag.
BugFix: Make notifier code consistent with AUR upgrades.
BugFix: Replaced 'Sync database' command text to 'Check updates'.
BugFix: Always do a "pacman -Syu" in System Upgrade.
BugFix: Notifier now uses "checkupdates" instead "pacman -Sy[y]". This means Octopi no longer can lead
the OS to a "partial updates" state and works gracefully with other package tools.
BugFix: Don't let user exits RepoEditor without answerig if he wants to save changes.
BugFix: Sometimes non-outdated AUR packages did not get refreshed.
BugFix: Now Actions tab is disable while in AUR mode.
BugFix: Make "Open terminal here" option work with qtermwidget.
BugFix: Added support for symbolic lynks in "open file".
BugFix: Pkg build date obeys Locale datetime format.
BugFix: SysInfo no longer pushes the collected logs to a remote paste service. It saves them locally.
BugFix: "exists in filesystem" messages during transactions are shown again.
BugFix: MultiselectionDialog did not resize pkg description automatically.
BugFix: Some packages were not displaying Optional Deps at Info tab.
BugFix: Huge delay when scrolling thru large package list.
BugFix: Speed improvements in package list building.
BugFix: OptionsDialog was not saving AUR settings if tab changed before clicking OK.
BugFix: Changed Manjaro news url.
BugFix: Notifier checked for available internet connection too early with an error dialog box.
BugFix: Changed command string to Reinstall/Update when package is already installed or outdated.
BugFix: Clear filter line edit when navigating thru package anchors at Info tab.
BugFix: Info and Files tabs were not showing any info automaticaly when switching between
foreign tool/pacman lists.
BugFix: Enable a more complete UI lockdown during transactions.
BugFix: Enable "Find a file" context menu option on a non installed pkg.
0.9.0 (2018-06-08)
Parser changes: added counter for processed packages.
Group pane now spans all window's height.
SysInfo now uses ptpb site and does not block interface.
Added Trizen (AUR tool) support.
Added Terminal tab if user compiles project with libqtermwidget5 support.
Added Terminal dialog in Notifier (AUR update) if user compiles project with
libqtermwidget5 support.
Added an Options dialog to Octopi and Notifier.
Added button after progressbar to stop current running transaction.
Added configurable "--noconfirm" and "--noedit" options to pacaur and "--noconfirm" to yaourt.
Added "Search/Use Instant Search" toggle.
Added slovenian translation (thanks to the translation crew).
Added support fo drag pacman packages to Octopi's mainwindow so they can be installed.
Added "Install Reason" field at Info tab.
Added support for ALPM utils lib (thanks to guinux, from Pamac project). So, now it's possible to
show "Download Size" in package list.
Added link support in all Info tab package lists.
Added option to upgrade outdated foreign packages from Octopi Notifier.
Added Hindi translation (thanks to Panwar108).
Name of AUR package in Info tab act as link to its site at https://aur.archlinux.org.
Search line edit is always focused when the program starts.
Prevent user to install partial upgrades in his system (ex: only some of the outdated packages).
Do NOT clear search string when switching between AUR/pacman.
BugFix: If threre are updated News after a synchronization, let's goto the News Tab.
BugFix: Remove only Octopi tools related temporary files (qtsingleapp*).
BugFix: Do not let program display an avalanche of internet related errors.
BugFix: Exec internet tests before some commands in Octopi and Notifier.
BugFix: Parser was not outputing repository errors when syncinc.
BugFix: repoeditor now runs as normal user and asks for root password on save.
BugFix: If Notifier hid Octopi and was closed, Octopi's window would stay hidden.
BugFix: Notifier's about dialog was never screen centered.
BugFix: When no AUR helper exists, the group of packages panel stayed disabled.
BugFix: Cache Cleaner now saves its window geometry.
BugFix: Infinite wait cursor in Cache Cleaner when user press Enter for more than two
seconds in the spin boxes.
BugFix: Some pkg download/installed sizes were not showing properly at Info tab.
BugFix: If we find an outdated AUR pkg in the official pkg list, we remove it.
BugFix: Install local packages did not work with space separated paths
(thanks to voanhcuoc for pointing it out).
BugFix: About and System Upgrade dialogs could be opened twice in notifier.
BugFix: Max time in minutes for notification interval was not honoring > 1380.
BugFix: Optional dependencies dialog can now be resized and new value is
persisted on disk.
BugFix: Using the alpm algorithm for package version comparison. Previous code
was reporting false newer packages.
BugFix: System upgrade button was not disabled while synching packages in notifier.
BugFix: searchlineedit font fix.
BugFix: 'yaourt' and 'pacaur' no longer honor "-a" option when querying outdated
foreign packages.
BugFix: System upgrade shortcut changed to "ctrl+P" as "ctrl+U" is used to cut text in
QLineEdit widgets.
BugFix: When user selected another search option, line edit was not being cleared.
BugFix: Disable alien icon while in transaction.
BugFix: Do not ask twice for password if a pacman lck file exists.
0.8.1 (2016-03-27)
BugFix: Updated CHAKRA RSS site (thanks to s8321414).
BugFix: Distro news now works with https KaOS site.
BugFix: Files tab was not refreshing when enabling KCP mode in KaOS.
BugFix: Do not permit two or more octopi instances if one is in root mode.
BugFix: When there's a pkg change outside Octopi, we trigger a flag to refresh the lists.
BugFix: When you were searching for a pkg and the Files tab was selected, focus got lost.
BugFix: Package dependencies with >, <, =, >= and <= signals were not clickable in Info tab.
BugFix: When user commits a transaction, commit and cancel buttons must get disabled.
Package list now also preserves sort column and sort order while in AUR/KCP/CCR mode.
Make Octopi more keyboard friendly.
Pressing <ENTER>, <RETURN> and <DELETE> keys on package list triggers package actions.
Stop using 'notify-send' in octopi-notifier: the era of annoying notifiers is over.
Major refactoring: Decoupling of Pacman executor and parser code from the UI as well as
SearchBar slots for QTextBrowser objects.
Added URL information to yaourt/pacaur remote pkgs at Info tab.
Added <F2> shortcut to focus package list.
Added an output dialog to notifier, so users can do a system upgrade without a terminal.
Added an entry for Mirror-check in Tools menu.
Added support for Simplified Chinese (zh_CN).
Added support for lxqt-sudo tool (thanks to Manjaro team).
Added "pkgfile -u" (if available) in sync db transaction.
0.8.0 (2015-11-08)
This is a Qt5 only version (with the exception of 'octopi-notifier').
BugFix: Speed optimizations in startup code (AUR outdated list).
BugFix: Octopi now honors the $SHELL variable (thanks to LAC1213).
BugFix: If user refused to remove pacman's lock file, commands
should be canceled!
BugFix: Sync Interval dialog was not showing strings in some languages.
BugFix: Package counters were not zeroing when searches found no results.
BugFix: In some very specific situations Info tab did not refresh info of
selected package.
BugFix: If user tried to sync db with kdesu and clicked "ESC", some garbage
went to Output tab.
BugFix: When user closed searchbar inside a QTextBrowser, cursor position was
reseted.
BugFix: Transaction dialog can now be resized and new value is persisted on disk.
BugFix: No columns warning while executing actions inside Octopi (thanks to flying-sheep).
BugFix: Cinnamon DE detection fix (thanks to jdelmas).
BugFix: Added option to search files with "\+" (escaping the plus sign). This would find things such
as C++ => "c\+\+" (thanks to maxis11).
Added support to "kcp --information" at Info tab.
Now Files tab shows a progressbar while building the list of files.
Yellow notifier icon tooltip now displays Foreign repo tool name.
When outdated packages are printed at Output tab, you can see their
information just hovering the mouse over them.
Added Parabola GNU/Linux-libre support (thanks to coadde).
Added galician translation (thanks to Ismael Ordóñez).
At Info tab, packages in "depends On" field are shown as clickable anchors.
Information tab now supports "ctrl+F" searching.
Help/About dialog now shows Pacman information.
StatusBar msg got updated with number of selected packages more visible.
0.7.0 (2015-04-27)
Major speed fix: Faster pkg list building.
Reverted to showing ALL packages at startup.
Added a systemd service to speed up the very first octopi startup time.
Added "Copy path to clipboard" context menu option in file list treeview.
Now pacman.conf's "IgnoreGroup" option is honored.
Disabled "View/Repository/[kcp | aur]" menu item.
Toolbar now shows AUR tool button instead of a fake pacman group.
Reenabled Pacaur support.
Now Package treeview columns get their widths saved.
Remove "Yes" button from transaction dialog, everytime 'pacman'
is one of the target packages.
SearchBar now reacts to an ENTER or RETURN key press to search for
next found item.
Added a notifier setup dialog to set "sync database" interval.
Generate a system info report if "gist" tool is available.
Added a "-d" switch to octopi and notifier to show some debug info.
BugFix: No more horizontal scrollbar in AUR mode.
BugFix: When a transaction is available, disable sync pkg and system
upgrade, as well as mirror-check and AUR mode.
BugFix: Repository column would get wider after switching from AUR
mode.
BugFix: Filter connect chain bug decreased filter's performance over time.
BugFix: Search by name was not being used after reverting from AUR search.
BugFix: F3 and Shift+F3 keys at SearchBar were not working.
BugFix: Sometimes downloaded and installed size information were in KiB,
instead of MiB.
BugFix: If user had no gksu/kdesu/root when clicking "clean" button in
cachecleaner, cursor would remain waiting (thanks to imperator-).
0.6.0 (2015-02-27)
BugFix: Pkg list was being refreshed twice sometimes.
BugFix: Removed some buggy strings from Output tab while in KF5.
BugFix: ArrowUp/Down, PageUp/Down and Home/End keys now refresh Package Info tab.
BugFix: Open file was not working in KF5.
BugFix: Filter by repo was not working with Qt 5.4 libs (thanks to sl1pkn07).
BugFix: Chakra CCR for installing pkgs was not being called.
BugFix: Notifier would not test for internet connection.
BugFix: Repoeditor uses user defined translation (if available) while launched from Octopi.
BugFix: Honor plural forms in some languages (thanks to SafaAlfulaij).
BugFix: When only notifier is installed, we don't refer Octopi in context menu nor
system upgrade dialog.
BugFix: Removed another buggy string while in plasma5.
BugFix: Opens install local pkg when you associate octopi to pacman files.
BugFix: PacmanHelper is a project related to Octopi-notifier (fix at PKGBUILD).
Always reset to "View ALL/ALL repos" when pkg group is changed.
Added more safety checks before running octopi-notifier.
Now notifier does not close Octopi.
Disabled Pacaur support.
Now PKGBUILD defaults to Qt5 builds.
At startup only installed packages are shown (if distro is not KaOS).
Added cachecleaner, a frontend to 'paccache' (thanks to Michaël Lhomme).
Added new KDE detection logic (thanks to Kirek).
KaOS only: added support for newer versions of Cellix's awesome KCP tool (much faster).
KaOS only: do a "kcp -u" sync while in "sync database" and notifier.
Refactorings in SearchLineEdit.
BugFixes in RepoEditor translation support (repoeditor is now in Transifex too).
0.5.0 (2014-11-08)
BugFix: RepoEditor would not compile with Qt5 lib (thanks to Philm).
BugFix: Suppress GConf error strings in output.
BugFix: mate-terminal is returning code 255 even when execution of
transaction was ok (thanks to ringo32).
BugFix: Keep groups panel hidden (if it were before) after pressing
F12 or F10.
BugFix: Merged offa's pull request that fixed a bunch of things.
BugFix: RepoEditor didn't take into account repo SigLevels while
saving .conf files.
Added Qt version in About dialog boxes (also in notifier).
Changed repoeditor icon to octopi_green.
Show/hide groups panel config is now persisted.
Now notifier syncs db once a day and save last synced time.
Changed package size to MiB when it was > 1024 KiB.
Added option "SyncDbHour" so notifier checks only when that specific hour ticks,
again once a day.
Added "sync db" menu option to notifier.
Added support for hiding/showing Octopi window in the new KF5 notifier code.
Added support for Ctrl+F in Output tab.
Added support for the user to choose his terminal by editing
~/.config/octopi/octopi.conf.
Added QtQuick code for user change terminal (only if Qt >= 5.3).
Added support for KStatusNotifier while in KDE (thanks to brcha).
Updated translations.
0.4.2 (2014-07-26)
BugFix: when searching AUR pkgs, given search string was not being matched
by package descriptions.
BugFix: Sometimes got a gconf bug string at sync db.
Updated a bunch of translations.
Added support for the new kcp tool (Go version).
0.4.1 (2014-07-12)
Added basque translation (thanks to tarteka).
Added es_AR translation (thanks to javier).
Added japanese translation (thanks to UTUMI Hirosi - utuhiro78).
Some coding refactorings regarding Yaourt/AUR as well as utils namespace.
BugFix: Tools menu was not being refreshed after a package
removal/installation.
BugFix: Ctrl and Shift key pkg actions not behaving right in Qt5
builds.
BugFix: When clicking a pkg on the outdated list, it could scroll
to a wrong pkg info.
BugFix: Adapted ArchBang changes.
BugFix: Removed unused Ctrl+N help text.
BugFix: Some changes in LXQt support.
BugFix: Download and installed size info at Info tab.
BugFix: The 'Enter' key (numeric keyboard) is now supported.
BugFix: At start when there is no pacman db, octopi hangs (thanks to anex).
BugFix: After a pkg list rebuild the Files and Info cache were not
being emptied.
Now downgrading operations appears in orange in Output tab.
Small fixes in packagemodel/package code (thanks to tbinkau).
Ctrl+C over an item in Files tab copies it's full path to Clipboard.
Reworked code to count installed packages (based on filters).
Leave some actions disabled before building pkg list and mirror-checking.
Added 'installed size' information in package tooltips.
Added Search by file feature (pacman -Qo).
Added a string validator in the search edit widget.
0.4.0 (2014-05-24)
Huge refactorings in model/view that brings consistent memory and
speed improvements - a single model and a central data storage (thanks to
Thomas Binkau - tbinkau).
BugFix: The transparent octopi notifier icon no longer shows a white bar in the
eyes (thanks to Ankde Boersma) .
BugFix: Fixed a jump bug when key-navigating in pkg list with Qt5 octopi.
BugFix: When a pkg is outdated, show all available information.
BugFix: Show warning if user do not have kdesu/gksu in sysupgrade/install local pkgs.
BugFix: System upgrade can not be available while in yaourt mode.
BugFix: Switching faster to yaourt mode if text field is empty.
BugFix: Ctrl+A is available in the package list panel.
BugFix: Now Shift+F3 and F3 search keys (and also Esc) work outside
SearchLineEdit widget.
BugFix: fixed freeze for install orphaned/yaourt package (thanks to
tbinkau).
BugFix: fixed notify-send code in octopi-notifier (thanks to vedgy).
BugFix: Files tab presented some nasty results sometimes and even a GPF when it
found symlinks to directories.
BugFix: running as root was broken in KDE.
BugFix: The preventing code for always refresh the pkg list was flawed.
BugFix: hasInternetConnection code fixed to improve mirror-check speed.
BugFix: Fixed CCR (Chakra) package installation/removal (thanks to dmnmsc).
BugFix: Disable group widget while searching for AUR packages.
Switched to "pacman -Syy" command when synching. It's safer.
Added support for Pacaur tool.
Added support to kcp in KaOS (thanks to Cellix).
Added support to LXQt DE.
Added support to ArchBSD news (thanks to bkc_).
Added support to Netrunner news.
Added support to mooOS distro (thanks to pdq).
Added support to Antergos distro (thanks to Yoyo).
Added popularity column (number of votes) in AUR/CCR mode (thanks to
tbinkau).
Added more filter options in View menu.
Added parameter "sysupgrade-noconfirm" so Octopi can jump automatically
to distro upgrade (if any new packages available) without prompt for
confirmation. Also added a "Yes" button to the sysupgrade
confirmation dialog at octopi-notifier (thanks to wget).
Merged Oktopi's code for using KDE icon theme, tools menu and CCR support
(thanks to Giuseppe Calà - gcala).
Changed sorting of the first column to also include the name column as second
sort criteria (thanks to tbinkau).
Added pacman log viewer and repoeditor support in tools menu (thanks to gcala).
Added asturian language in Qt5 builds (thanks to Llumex03).
Patched repoeditor to run just one instance at a time.
The filelist search now searches directories too.
Refactorings here and there to make it more Chakra friendly.
Updated README file.
Updated some icons to unclutter the UI (thanks to Anke Boersma).
Refactoring in some code to not generate translatable strings.
Fixed getBuildDate code to always convert dates to english format.
Updated some translations.
0.3.2 (2014-02-14)
Cleaned unused code.
Added icon for mirror-check while in KaOS.
Does a mirror-check at startup while in KaOS.
Added icon for system upgrade.
Added system upgrade button in octopi's toolbar.
BugFix: Navigating in the package list using [A..Z] keys did not work as
expected.
BugFix: When the package list is filtered and you click in a package which is in
the outdated package list, you are redirected to a blank information tab.
BugFix: When the groups button is pressed and the lower pane is maximized, the
former is hidden by the later.
BugFix: When the user had no yaourt in the system, there were a zombie
octopi process 'left running'.
0.3.1 (2014-01-14)
Added support for Qt5.
Added chinese (Taiwan), malay, slovak and ukrainian translations.
Added support to KaOS, a lean KDE centric Linux distro.
Added support to installation of local packages with GUI feedback.
Updated translations.
Changed widget for package groups, from combobox to treeview.
BugFix: When inserting an optional dependency package or removing a dep,
first searches into transaction queue for them.
BugFix: Prevent header resizing in File and Transaction tabs.
0.3.0 (2013-11-03)
Code cleanings.
BugFix: No need to refresh package list after a cache clean.
BugFix: Konsole was not working with yaourt package installation.
BugFix: Position of search icon in searchedit sometimes was wrong.
BugFix: Some actions did not get disabled while executing a transaction.
BugFix: Use -Ss option while searching for yaourt packages.
BugFix: Don't show package names in yaourt package descriptions.
BugFix: Better RazorQt compatibility.
BugFix: Notifier: clear tooltip if no update is available (thanks to
Anselmo L. S. Melo - anselmolsm).
BugFix: When refreshing packages from a group, the list could become
outdated if the user had installed/removed some package.
BugFix: Use "yaourt -S aur/pkgname" to install yaourt packages
(thanks to ringo32).
BugFix: Octopi was only showing the first Optional Deps in some cases.
Brought back the option to do a graphical system upgrade.
Now when installing a package with optional dependencies, Octopi lets users choose
which optional dependencies (if any) they want to install.
Now when removing a package with dependencies, Octopi lets users choose which one they
want to remove.
Now Get Latest Distro News doesn't freeze the interface.
Changed octopi main icon to octopi-green.png in PKGBUILD and
octopi.desktop.
Added menu "Octopi" and "System Upgrade" in octopi-notifier.
Show Yaourt packages as outdated in default package list.
Now it's possible to upgrade Yaourt packages even outside Yaourt group.
Now the yellow octopi icon means there are outdated yaourt packages.
Now octopi-notifier opens only the transaction dialog if Octopi is not running
and user requests a system upgrade.
Added support to remove Pacman's transaction lock file.
Added a new notification for outdated packages on statusbar.
Added a new status icon: an orange one for newer than repo
installed packages.
Added spanish (Latin America) translation.
Added english (Great Britain) translation.
Added portuguese (Portugal) translation.
Added swedish translation.
Added serbian translation.
Added hungarian translation.
Added new "foreign_red.png" and "octopi_green.png" icons (thanks to Alex
Fredrich).
Added support for pkgfile to view uninstalled package file list while in
ArchLinux/ArchBang (thanks to Damián Nohales).
Added an About Dialog to Octopi Notifier.
Updated translations.
0.2.0 (2013-08-24)
Splitted the project in "octopi" and "octopi-notifier".
Yaourt no longer runs with root permissions.
Added support for package multi selection in Yaourt mode.
Added option to install local packages.
Added support for "notify-send" in "octopi-notifier".
Added hebrew translation.
Added lithuanian translation.
Added norwegian bokmål translation.
Added servian latin translation.
Added dutch translation.
Added russian translation.
Added uzbek translation.
Added finnish translation.
Added vietnamese translation.
Updated all other translations.
GTK native theme is used by default in Manjaro (while not in KDE).
Added support for Xterm terminal.
IgnorePkg option is now used to build outdated package list.
BugFix: Empty pkg descriptions are now shown as empty.
0.1.9.1 (2013-07-14)
Important bugfixes to deal with multithreaded code.
Added a "globals.h/.cpp" file to group QFutureWatcher globals.
Updated style changing code in main.cpp.
BugFix: when user cancelled a sysupgrade transaction inside a
terminal, the package actions remained disabled.
0.1.9 (2013-07-09)
Added yaourt support.
Updated most of the translations.
0.1.8 (2013-06-16)
Added czech translation.
Added support to ArchBang Linux.
Added a systemtray icon notifier feature using DBus technology.
0.1.7.3 (2013-05-26)
Added a TRANSLATIONS file.
Added danish translation.
Added indonesian translation.
@@ -8,14 +645,14 @@
Bugfix: sysupgrade must refresh packagelist after syncdatabase.
Bugfix: if sysupgrade uses SyncFirst, makes it automatically start a second upgrade.
0.1.7.2
0.1.7.2 (2013-05-17)
Added catalan translation.
Bugfix: updated new binary translation files to the resources.
0.1.7.1
0.1.7.1 (2013-05-11)
Bugfix: menu icons were not being shown while in Xfce.
0.1.7
0.1.7 (2013-05-11)
Added "-sysupgrade" command line option.
Added "-removecmd" command line option.
Added lots of translations.
@@ -23,11 +660,11 @@
Added an About dialog.
Changed the old About tab to Usage tab.
0.1.6.1
0.1.6.1 (2013-04-25)
Added pt_BR translation.
Added "Open root terminal" option in File menu.
0.1.6
0.1.6 (2013-04-12)
Added a new Transaction Dialog.
Added a Firefox-like search inside Files, News and About tabs.
Added support for Chakra.
@@ -35,33 +672,33 @@
Added option to execute any transaction inside a terminal.
Changed ProgressDialog to a progressBar at the screen bottom.
0.1.5
0.1.5 (2013-04-06)
Added option to search packages by description and name.
Added support for pacman version 4.1.
Transactions with conflict errors can be re-executed inside a terminal.
Reworked Manjaro Linux theme.
0.1.4.1
0.1.4.1 (2013-03-30)
Bugfix release
Added total download size information in transaction dialog.
0.1.4
0.1.4 (2013-03-28)
Added a Manjaro Linux theme.
Changed position of filter line edit to the toolbar.
0.1.3
0.1.3 (2013-03-19)
Added better support to Qt dark themes.
Added context menu support inside Files tab.
Made URLs clickable inside output tab.
Made URLs clickable inside Output tab.
Fixed the annoying Packager information display bug.
0.1.2
0.1.2 (2013-03-18)
Tons of refactorings and bugfixes.
Small changes in UI.
0.1.1
0.1.1 (2013-03-17)
Added all six tabs.
Added support for groups of packages.
0.1.0
0.1.0 (2013-03-11)
Initial Proof of Concept release.

130
CMakeLists.txt Normal file
View File

@@ -0,0 +1,130 @@
cmake_minimum_required(VERSION 3.5)
project(octopi VERSION 0.19.0 LANGUAGES CXX)
set(CMAKE_CXX_STANDARD 17)
set(CMAKE_CXX_STANDARD_REQUIRED ON)
set(CMAKE_THREAD_PREFER_PTHREAD True)
set(CMAKE_RUNTIME_OUTPUT_DIRECTORY "${CMAKE_CURRENT_BINARY_DIR}")
option(USE_QTERMWIDGET6 "Build with qtermwidget6 instead of qtermwidget5" ON)
add_subdirectory(helper)
add_subdirectory(notifier)
add_subdirectory(cachecleaner)
add_subdirectory(repoeditor)
if (USE_QTERMWIDGET6)
find_package(Qt6 REQUIRED COMPONENTS Core Core5Compat Gui Network Xml Widgets LinguistTools Multimedia)
find_package(qtermwidget6 REQUIRED)
else()
find_package(Qt5 REQUIRED COMPONENTS Core Gui Network Xml Widgets LinguistTools Multimedia)
find_package(qtermwidget5 REQUIRED)
endif()
find_package(alpm_octopi_utils REQUIRED)
set(CMAKE_AUTOMOC ON)
file(GLOB TS_FILES LIST_DIRECTORIES false "${CMAKE_CURRENT_LIST_DIR}/resources/translations/*.ts")
qt_add_translation(qmFiles ${TS_FILES})
set(src
src/QtSolutions/qtsingleapplication.cpp
src/QtSolutions/qtlocalpeer.cpp
repoeditor/repoentry.cpp
src/aurvote.cpp
src/propertiestabwidget.cpp
src/qaesencryption.cpp
src/repoconf.cpp
src/main.cpp
src/mainwindow.cpp
src/strconstants.cpp
src/searchlineedit.cpp
src/argumentlist.cpp
src/settingsmanager.cpp
src/package.cpp
src/unixcommand.cpp
src/wmhelper.cpp
src/treeviewpackagesitemdelegate.cpp
src/mainwindow_init.cpp
src/mainwindow_transaction.cpp
src/mainwindow_events.cpp
src/mainwindow_help.cpp
src/searchbar.cpp
src/mainwindow_searchbar.cpp
src/transactiondialog.cpp
src/mainwindow_news.cpp
src/mainwindow_refresh.cpp
src/globals.cpp
src/multiselectiondialog.cpp
src/packagerepository.cpp
src/model/packagemodel.cpp
src/ui/octopitabinfo.cpp
src/utils.cpp
src/terminal.cpp
src/pacmanexec.cpp
src/optionsdialog.cpp
src/packagetreeview.cpp
src/termwidget.cpp
src/alpmbackend.cpp)
set(header
src/QtSolutions/qtsingleapplication.h
src/QtSolutions/qtlocalpeer.h
repoeditor/repoentry.h
src/aurvote.h
src/propertiestabwidget.h
src/qaesencryption.h
src/repoconf.h
src/mainwindow.h
src/strconstants.h
src/searchlineedit.h
src/argumentlist.h
src/settingsmanager.h
src/uihelper.h
src/package.h
src/unixcommand.h
src/wmhelper.h
src/treeviewpackagesitemdelegate.h
src/searchbar.h
src/transactiondialog.h
src/globals.h
src/multiselectiondialog.h
src/packagerepository.h
src/model/packagemodel.h
src/ui/octopitabinfo.h
src/utils.h
src/terminal.h
src/pacmanexec.h
src/constants.h
src/optionsdialog.h
src/packagetreeview.h
src/termwidget.h
src/alpmbackend.h)
set(ui ui/mainwindow.ui ui/transactiondialog.ui ui/multiselectiondialog.ui ui/optionsdialog.ui)
set(qrc resources.qrc)
qt_wrap_ui(src ${ui})
qt_add_resources(src ${qrc})
add_executable(octopi ${src} ${header} ${qmFiles})
target_compile_definitions(octopi PRIVATE OCTOPI_EXTENSIONS ALPM_BACKEND QT_DEPRECATED_WARNINGS QT_USE_QSTRINGBUILDER QT_NO_CAST_FROM_ASCII QT_NO_CAST_TO_ASCII QT_NO_URL_CAST_FROM_STRING QT_NO_CAST_FROM_BYTEARRAY)
if (USE_QTERMWIDGET6)
target_include_directories(octopi PRIVATE ${CMAKE_CURRENT_SOURCE_DIR} ${CMAKE_CURRENT_BINARY_DIR} ${Qt6Core_INCLUDE_DIRS} ${Qt6Gui_INCLUDE_DIRS} ${Qt6Network_INCLUDE_DIRS} ${Qt6Xml_INCLUDE_DIRS} ${Qt6Widgets_INCLUDE_DIRS})
target_link_libraries(octopi PRIVATE Qt6::Core Qt6::Gui Qt6::Network Qt6::Xml Qt6::Widgets Qt6::Multimedia qtermwidget6 alpm_octopi_utils)
else()
target_include_directories(octopi PRIVATE ${CMAKE_CURRENT_SOURCE_DIR} ${CMAKE_CURRENT_BINARY_DIR} ${Qt5Core_INCLUDE_DIRS} ${Qt5Gui_INCLUDE_DIRS} ${Qt5Network_INCLUDE_DIRS} ${Qt5Xml_INCLUDE_DIRS} ${Qt5Widgets_INCLUDE_DIRS})
target_link_libraries(octopi PRIVATE Qt5::Core Qt5::Gui Qt5::Network Qt5::Xml Qt5::Widgets Qt5::Multimedia qtermwidget5 alpm_octopi_utils)
endif()
file(COPY "${CMAKE_CURRENT_SOURCE_DIR}/resources/images/octopi_green.png" DESTINATION "${CMAKE_CURRENT_BINARY_DIR}")
file(RENAME "${CMAKE_CURRENT_BINARY_DIR}/octopi_green.png" "${CMAKE_CURRENT_BINARY_DIR}/octopi.png")
install(TARGETS octopi RUNTIME DESTINATION bin LIBRARY DESTINATION lib PUBLIC_HEADER DESTINATION include)
install(FILES "${CMAKE_CURRENT_SOURCE_DIR}/octopi.desktop" DESTINATION share/applications)
install(FILES "${CMAKE_CURRENT_BINARY_DIR}/octopi.png" "${CMAKE_CURRENT_SOURCE_DIR}/resources/images/octopi_green.png" DESTINATION share/icons/hicolor/48x48/apps)
install(FILES "${CMAKE_CURRENT_BINARY_DIR}/octopi.png" "${CMAKE_CURRENT_SOURCE_DIR}/resources/images/octopi_green.png"
"${CMAKE_CURRENT_SOURCE_DIR}/resources/images/octopi_red.png" "${CMAKE_CURRENT_SOURCE_DIR}/resources/images/octopi_yellow.png" DESTINATION share/icons/hicolor/48x48/apps)
install(FILES "${CMAKE_CURRENT_SOURCE_DIR}/LICENSE" DESTINATION share/licenses/octopi)

15
INSTALL
View File

@@ -1,10 +1,17 @@
Installing Octopi is a pretty straightforward task.
Assuming you have updated Qt4 libs installed in your system, just:
Assuming you have updated Qt5 libs installed in your system, all
you have to do is run:
1) ./qmake
2) make
makepkg -f
Wait for the compilation and then install the generated package (as
root), using:
pacman -U <nameOfTheGeneratedOctopiPackage.tar.[xz|zst]>
Octopi is located on the system utilities menu of your Desktop
Environment.
Octopi's binary will be generated in "./bin" dir.
Enjoy!

View File

@@ -1,43 +1,53 @@
pkgname=octopi
pkgver=0.1.7.3
_pkgname=octopi
pkgname=octopi-git
pkgver=0.19.0.latest
pkgrel=1
pkgdesc="a powerful Pacman frontend using Qt libs"
pkgdesc="This is Octopi, a powerful Pacman frontend using Qt libs (git checkout)"
url="https://tintaescura.com/projects/octopi/"
arch=('i686' 'x86_64')
url="http://octopiproject.wordpress.com"
license=('GPL2')
install=$pkgname.install
depends=('alpm_octopi_utils' 'qtermwidget' 'sudo')
makedepends=('git')
depends=('qt4')
provides=('octopi')
conflicts=('octopi')
md5sums=()
_gitroot="git://github.com/aarnt/octopi.git"
_gitname="octopi"
groups=('system')
source=("git+https://github.com/aarnt/octopi.git")
md5sums=('SKIP')
prepare() {
cd "${_pkgname}"
cp resources/images/octopi_green.png resources/images/octopi.png
}
#pkgver() {
# cd "${_pkgname}"
# git describe --long --tags --abbrev=7 | sed 's/\([^-]*-g\)/r\1/;s/-/./g;s/^v//'
#}
build() {
cpucount=$(grep -c processor /proc/cpuinfo 2>/dev/null)
jc=$((${cpucount:-1}))
cd "${_pkgname}"
echo "Starting build..."
qmake6 PREFIX=/usr QMAKE_CFLAGS="${CFLAGS}" QMAKE_CXXFLAGS="${CXXFLAGS}" QMAKE_LFLAGS="${LDFLAGS}" octopi.pro
make
#cd "$srcdir"
msg "Starting build..."
_subdirs="cachecleaner helper notifier repoeditor"
cd $startdir
qmake-qt4 $pkgname.pro
#"CONFIG+=LINUX_INTEGRATED" \
#"INSTALL_ROOT_PATH=$pkgdir/usr/" \
#"LOWERED_APPNAME=$pkgname"
make -j $jc
for _subdir in $_subdirs; do
pushd $_subdir
echo "Building octopi-$_subdir..."
qmake6 PREFIX=/usr QMAKE_CFLAGS="${CFLAGS}" QMAKE_CXXFLAGS="${CXXFLAGS}" QMAKE_LFLAGS="${LDFLAGS}" "octopi-$_subdir.pro"
make
popd
done
}
package() {
#cd "$srcdir/$pkgname"
cd "${_pkgname}"
make INSTALL_ROOT="${pkgdir}" install
install -D -m755 $startdir/bin/$pkgname ${pkgdir}/usr/bin/$pkgname
install -D -m644 $startdir/$pkgname.desktop ${pkgdir}/usr/share/applications/$pkgname.desktop
install -D -m644 $startdir/resources/images/${pkgname}_yellow.png ${pkgdir}/usr/share/icons/$pkgname.png
_subdirs="cachecleaner helper notifier repoeditor"
#make DESTDIR="${pkgdir}" install
#make INSTALL_ROOT=${pkgdir} install
for _subdir in $_subdirs; do
pushd $_subdir
make INSTALL_ROOT="${pkgdir}" install
popd
done
}

8
README
View File

@@ -1,8 +0,0 @@
This is Octopi, a powerful Pacman frontend using Qt libs.
The project's source code is hosted at https://github.com/aarnt/octopi.
You'll need a privilege escalation tool to use it, once running it as
root will not work. Octopi supports kdesu and gksu for that.
Enjoy!

148
README.md Normal file
View File

@@ -0,0 +1,148 @@
## This is Octopi, a powerful Pacman/AUR front end using Qt libs.
![Main window](https://raw.githubusercontent.com/aarnt/octopi/master/octopi-mainwindow.png)
![Options dialog](https://raw.githubusercontent.com/aarnt/octopi/master/octopi-optionsdialog.png)
![Main window with qss](https://raw.githubusercontent.com/aarnt/octopi/master/octopi-mainwindow-with-qss.png)
The project site is hosted on https://tintaescura.com/projects/octopi
Currently, 11 Linux distros are compatible with it
* [ArchBang](http://archbang.org/)
* [Archcraft](https://archcraft.io/)
* [Arch Linux](https://www.archlinux.org/)
* [ArcoLinux](https://arcolinux.info/)
* [Artix Linux](https://artixlinux.org)
* [CachyOS](https://cachyos.org/)
* [EndeavourOS](https://endeavouros.com/)
* [Garuda Linux](https://garudalinux.org/)
* [KaOS](https://kaosx.us/)
* [Manjaro](https://manjaro.org/)
* [Obarun Linux](https://web.obarun.org/index.php?id=1)
### What you must install in order to have Octopi fully functional
You'll need:
* [Alpm_octopi_utils](https://github.com/aarnt/alpm_octopi_utils/) library
* A helper to execute pacman commands called "octphelper", available on "./helper" dir
* A privilege escalation tool called [qt-sudo](https://github.com/aarnt/qt-sudo/)
* qtermwidget package, in order to build Octopi with embedded terminal support
### To install Octopi using pacman
If Octopi package is available in your distro's repository, you can just type:
```
# pacman -S octopi
```
### Steps to build Octopi source code (qmake)
Assuming you have vala compiler and Qt6 libs properly installed, follow these steps:
```
$ git clone https://github.com/aarnt/alpm_octopi_utils
$ cd alpm_octopi_utils
$ make
# make install
$ cd ..
$ git clone https://github.com/aarnt/qt-sudo
$ cd qt-sudo
$ qmake6
$ make
# make install
$ cd ..
$ git clone https://github.com/aarnt/octopi
$ cd octopi/helper
$ qmake6
$ make
# make install
$ cd ../notifier
$ qmake6
$ make
# make install
$ cd ../cachecleaner
$ qmake6
$ make
# make install
$ cd ../repoeditor
$ qmake6
$ make
# make install
$ cd ..
$ qmake6
$ make
# make install
```
You can also use the available PKGBUILD script that helps you build latest Octopi development version with all its tools(*):
```
$ cd OCTOPI_PATH (where you git cloned the source code)
$ makepkg -f
```
(*) It may contain bugs. You have been warned.
### Steps to build Octopi source code (CMake)
As an alternative to qmake, Octopi can also be built with CMake. Make sure that at least CMake 3.5 is installed.
First, build and install alpm_octopi_utils:
```
$ git clone https://github.com/aarnt/alpm_octopi_utils
$ cd alpm_octopi_utils
$ mkdir build_dir && cd build_dir
$ cmake -G "Unix Makefiles" .. -DCMAKE_BUILD_TYPE=Release -DCMAKE_INSTALL_PREFIX=/usr
$ make
$ sudo make install
```
Next, build and install Octopi:
```
$ git clone https://github.com/aarnt/octopi
$ cd octopi
$ mkdir build_dir && cd build_dir
$ cmake -G "Unix Makefiles" .. -DCMAKE_BUILD_TYPE=Release -DCMAKE_INSTALL_PREFIX=/usr
$ make
$ sudo make install
```
### To run Octopi
```
$ /usr/bin/octopi
```
### To run Octopi Notifier
```
$ /usr/bin/octopi-notifier
```
### To enable AUR support (that "green alien" icon on toolbar)
You'll need to install [pacaur](https://github.com/rmarquis/pacaur), [paru](https://github.com/morganamilo/paru),
[pikaur](https://github.com/actionless/pikaur), [trizen](https://github.com/trizen/trizen) or
[yay](https://github.com/Jguer/yay) in your system.
If neither of the previous tools are found Octopi will download latest "yay-bin" github binary.
In KaOS, [kcp](https://codeberg.org/bvaudour/kcp) will be supported out of the box.
### Ways to help/support Octopi
* You can "Star" it on the Github page - https://github.com/aarnt/octopi/
* You can vote in the AUR package available on https://aur.archlinux.org/packages/octopi/
* You can translate it to your mother language on https://explore.transifex.com/arnt/octopi/
* You can follow author's twitter account on https://twitter.com/aaarnt
* You can buy author's technical book (currently in portuguese) about Octopi and Qt5 on
http://www.amazon.com.br/Aprendendo-Qt-com-projeto-Octopi-ebook/dp/B015ICHKV6
* You can buy author's poem book (currently in portuguese) on meditation, Buddhism, cosmology and other subjects on
https://www.amazon.com.br/Avidya-Alexandre-Arnt-ebook/dp/B0965LVWR3
* You can write a review about it (text / video)
* You can donate money to the author's Paypal - http://sourceforge.net/donate/index.php?group_id=186459
* You can join the project ;-)
Enjoy!

17
THANKS
View File

@@ -1,13 +1,26 @@
A very special thanks goes to:
- Alex Fredrich, for testing and suggestions
- All Octopi translators listed in TRANSLATIONS file!
- Alex Fredrich, for testing, suggestions and icons
- Anke Boersma (demm), for supporting Octopi in KaOS
- Bernardo M. Savone (Bersil), for testing and spreading the word
- Damián Nohales (eagleoneraptor), for pkgfile support
- Edgar Aloísio Berger, for spreading the word by email
- Filip Brcic (brcha), for KStatusNotifier support
- Giuseppe Calà (gcala), for merging changes from Oktopi's code
- Jordi (dmnmsc), for testing in Chakra Linux
- Jose Martinez (dsngjoe), for testing under Cinnamon
- Manjaro community, for testing and suggestions
- Manuel Tortosa, for testing, suggestions and code
- Philip Müller, for testing, patches and suggestions
- Philip Müller (philm), for testing, patches and suggestions
- pdq, for implementing mooOS compatibility
- Riberti de Almeida Felisbino (Holmes), for spreading the word at Manjaro Linux
Brasil
- Ringo de kroon (ringo32), for testing and lots of suggestions
- Sami Korkalainen (Sami-Perkele), for testing and suggestions
- Thomas Binkau (tbinkau), for patches and suggestions
- Valdir Rossi Belmonte Filho, for patching the site
- vedgy, for patches and suggestions
- Yoyo Fernández (Yoyo), for spreading the word and testing
Octopi has got much better with all your help!

View File

@@ -1,15 +1,45 @@
To get a better picture of who are ALL Octopi translators, please access
https://www.transifex.com/projects/p/octopi/. Bellow we have only a small
list of them:
Arabic: karim (Karim Oulad Chalha)
Asturian: Llumex03
Basque: tarteka (Sergio Moreno)
Brazilian Portuguese: arnt (Alexandre Albuquerque Arnt)
Bulgarian: loot270 (Galin Iskrenov)
Catalan: oriolfa (Oriol Fernandez)
Chinese (Taiwan): s8321414 (冥王歐西里斯)
Croatian: rokadar (Robert Okadar)
Czech: fri
Danish: Snubbi (Carl Andersen)
English (source language)
Dutch: jsm (Jasper van der Marel)
English: source language
English (Great Britain): jonathon (J Fernyhough)
Finnish: Sami Korkalainen (Sami-Perkele)
French: Loubrix (David Roux)
Galician: Isorfe (Ismael Ordóñez)
German: Veraendert
Greek: angel_solomos
Hebrew: GenghisKhan
Hungarian: lajos (Lajos Pasztor)
Indonesian: Se7enTime (Mohamad Hasan Al Banna)
Italian: bersil (Bernardo Miguel Savone)
Japanese: (UTUMI Hirosi) utuhiro78
Lithuanian: liudas (Liudas Ališauskas)
Malay: Puretech
Norwegian Bokmål: viking60
Polish: poker98face (Kuba Kaczmarzyk)
Portuguese: arcorreia (António Correia)
Romanian: Ayceman (Alexandru Ianu)
Spanish: tufadorin
Russian: macbet (Daniil) and ualmasov (Umidjon Almasov)
Serbian: milenkin (Milena Petrović)
Serbian-latin: GameBoyT (GameBoy)
Slovak: roslav
Spanish: tufadorin and yoyo308 (Yoyo Fernández)
Spanish - Argentina: (javier)
Spanish - Latin America: CostGranda (Cost Granda)
Swedish: riiga
Turkish: yfdogan (Yusuf Faruk DOĞAN)
Ukrainian: zubr139
Uzbek: ualmasov (Umidjon Almasov)
Vietnamese: ppanhh (Anh Phan)

11
cachecleaner/.tx/config Normal file
View File

@@ -0,0 +1,11 @@
[main]
host = https://www.transifex.com
[o:arnt:p:octopi:r:cachecleaner]
file_filter = resources/translations/octopi_cachecleaner_<lang>.ts
source_file = resources/translations/octopi_cachecleaner_en.ts
source_lang = en
type = QT
replace_edited_strings = false
keep_translations = false

View File

@@ -0,0 +1,66 @@
if (USE_QTERMWIDGET6)
find_package(Qt6 REQUIRED COMPONENTS Core Network Xml Widgets LinguistTools)
else()
find_package(Qt5 REQUIRED COMPONENTS Core Network Xml Widgets LinguistTools)
endif()
set(CMAKE_AUTOMOC ON)
file(GLOB TS_FILES LIST_DIRECTORIES false "${CMAKE_CURRENT_LIST_DIR}/resources/translations/*.ts")
qt_add_translation(qmFiles ${TS_FILES})
set(src
main.cpp
cachecleaner.cpp
packagegroupmodel.cpp
../src/strconstants.cpp
../src/qaesencryption.cpp
../src/unixcommand.cpp
../src/wmhelper.cpp
../src/terminal.cpp
../src/settingsmanager.cpp
../src/searchlineedit.cpp
../src/utils.cpp
../src/package.cpp
../src/QtSolutions/qtsingleapplication.cpp
../src/QtSolutions/qtlocalpeer.cpp
#../src/QtSolutions/qtlockedfile.cpp
../src/QtSolutions/qtsinglecoreapplication.cpp)
set(header
cachecleaner.h
packagegroupmodel.h
../src/strconstants.h
../src/qaesencryption.h
../src/unixcommand.h
../src/wmhelper.h
../src/terminal.h
../src/settingsmanager.h
../src/searchlineedit.h
../src/utils.h
../src/package.h
../src/QtSolutions/qtsingleapplication.h
../src/QtSolutions/qtlocalpeer.h
#../src/QtSolutions/qtlockedfile.h
../src/QtSolutions/qtsinglecoreapplication.h)
set(ui ui/cachecleaner.ui)
set(qrc resources.qrc)
qt_wrap_ui(src ${ui})
qt_add_resources(src ${qrc})
add_executable(octopi-cachecleaner ${src} ${header} ${qmFiles})
target_compile_definitions(octopi-cachecleaner PRIVATE QT_USE_QSTRINGBUILDER QT_NO_CAST_FROM_ASCII QT_NO_CAST_TO_ASCII QT_NO_URL_CAST_FROM_STRING QT_NO_CAST_FROM_BYTEARRAY)
if (USE_QTERMWIDGET6)
target_include_directories(octopi-cachecleaner PRIVATE ${CMAKE_CURRENT_BINARY_DIR} "${CMAKE_CURRENT_SOURCE_DIR}/src/QtSolutions" ${Qt6Core_INCLUDE_DIRS} ${Qt6Network_INCLUDE_DIRS} ${Qt6Xml_INCLUDE_DIRS} ${Qt6Widgets_INCLUDE_DIRS})
target_link_libraries(octopi-cachecleaner PRIVATE Qt6::Core Qt6::Network Qt6::Xml Qt6::Widgets)
else()
target_include_directories(octopi-cachecleaner PRIVATE ${CMAKE_CURRENT_BINARY_DIR} "${CMAKE_CURRENT_SOURCE_DIR}/src/QtSolutions" ${Qt5Core_INCLUDE_DIRS} ${Qt5Network_INCLUDE_DIRS} ${Qt5Xml_INCLUDE_DIRS} ${Qt5Widgets_INCLUDE_DIRS})
target_link_libraries(octopi-cachecleaner PRIVATE Qt5::Core Qt5::Network Qt5::Xml Qt5::Widgets)
endif()
install(TARGETS octopi-cachecleaner RUNTIME DESTINATION bin LIBRARY DESTINATION lib PUBLIC_HEADER DESTINATION include)
install(FILES "${CMAKE_CURRENT_SOURCE_DIR}/octopi-cachecleaner.desktop" DESTINATION share/applications)

View File

@@ -0,0 +1,159 @@
/*
Copyright 2015 Michaël Lhomme
This file is part of AppSet.
AppSet is free software; you can redistribute it and/or modify
it under the terms of the GNU General Public License as published by
the Free Software Foundation; either version 2 of the License, or
(at your option) any later version.
AppSet is distributed in the hope that it will be useful,
but WITHOUT ANY WARRANTY; without even the implied warranty of
MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
GNU General Public License for more details.
You should have received a copy of the GNU General Public License
along with AppSet; if not, write to the Free Software
Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
*/
#include "cachecleaner.h"
#include "ui_cachecleaner.h"
#include "../src/strconstants.h"
#include <QKeyEvent>
#include <QTcpServer>
#include <QTcpSocket>
#include <QMessageBox>
/*
* CacheCleaner window constructor
*/
CacheCleaner::CacheCleaner(QWidget *parent) :
QMainWindow(parent),
ui(new Ui::CacheCleaner)
{
//UI initialization
ui->setupUi(this);
int keepInstalled = SettingsManager::getKeepNumInstalledPackages();
ui->keepInstalledPackagesSpinner->setValue(keepInstalled);
int keepUninstalled = SettingsManager::getKeepNumUninstalledPackages();
ui->keepUninstalledPackagesSpinner->setValue(keepUninstalled);
//create package group wrappers
m_installed = new PackageGroupModel(QLatin1String(""),
ui->installedPackagesList,
ui->keepInstalledPackagesSpinner,
ui->refreshInstalledButton,
ui->cleanInstalledButton);
m_uninstalled = new PackageGroupModel(QStringLiteral("-u"),
ui->uninstalledPackagesList,
ui->keepUninstalledPackagesSpinner,
ui->refreshUninstalledButton,
ui->cleanUninstalledButton);
m_tcpServer = new QTcpServer(this);
connect(m_tcpServer, &QTcpServer::newConnection, this, &CacheCleaner::onSendInfoToOctopiHelper);
restoreGeometry(SettingsManager::getCacheCleanerWindowSize());
}
/*
* Cache Cleaner destructor
*/
CacheCleaner::~CacheCleaner()
{
delete m_installed;
delete m_uninstalled;
delete ui;
}
/*
* Start listening for helper connections
*/
bool CacheCleaner::startServer()
{
bool res=true;
if (!m_tcpServer->listen(QHostAddress::LocalHost, 12703))
{
QMessageBox::critical(this, StrConstants::getApplicationName(),
QStringLiteral("Unable to start the server: %1.")
.arg(m_tcpServer->errorString()));
res=false;
}
return res;
}
/*
* Answers Helper if CacheCleaner is executing actions
*/
void CacheCleaner::onSendInfoToOctopiHelper()
{
QString msg;
QByteArray block;
QDataStream out(&block, QIODevice::WriteOnly);
out.setVersion(QDataStream::Qt_5_15);
//Is octopi-helper running?
bool isHelperExecuting=UnixCommand::isOctopiHelperRunning();
bool commandExecuting = (m_installed->isExecutingCommand || m_uninstalled->isExecutingCommand);
if (isHelperExecuting && commandExecuting)
{
msg=QLatin1String("Octopi est occupatus");
out << msg;
}
else if (isHelperExecuting && !commandExecuting)
{
msg=QLatin1String("Octopi serenum est");
out << msg;
}
else
{
msg=QLatin1String("Atramento nigro");
out << msg;
}
QTcpSocket *clientConnection = m_tcpServer->nextPendingConnection();
if (clientConnection->isOpen())
{
connect(clientConnection, &QAbstractSocket::disconnected,
clientConnection, &QObject::deleteLater);
clientConnection->write(block);
clientConnection->disconnectFromHost();
}
//m_installed->isExecutingCommand=false;
//m_uninstalled->isExecutingCommand=false;
}
/*
* Save settings when closing window
*/
void CacheCleaner::closeEvent(QCloseEvent *)
{
QByteArray windowSize=saveGeometry();
SettingsManager::setCacheCleanerWindowSize(windowSize);
SettingsManager::setKeepNumInstalledPackages(ui->keepInstalledPackagesSpinner->value());
SettingsManager::setKeepNumUninstalledPackages(ui->keepUninstalledPackagesSpinner->value());
}
/*
* Whenever user presses ESC, we quit the program
*/
void CacheCleaner::keyPressEvent(QKeyEvent *ke)
{
if (ke->key() == Qt::Key_Escape)
{
close();
}
}

View File

@@ -0,0 +1,60 @@
/*
Copyright 2015 Michaël Lhomme
This file is part of AppSet.
AppSet is free software; you can redistribute it and/or modify
it under the terms of the GNU General Public License as published by
the Free Software Foundation; either version 2 of the License, or
(at your option) any later version.
AppSet is distributed in the hope that it will be useful,
but WITHOUT ANY WARRANTY; without even the implied warranty of
MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
GNU General Public License for more details.
You should have received a copy of the GNU General Public License
along with AppSet; if not, write to the Free Software
Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
*/
#ifndef CACHECLEANER_H
#define CACHECLEANER_H
#include <QMainWindow>
#include "packagegroupmodel.h"
class QTcpServer;
namespace Ui {
class CacheCleaner;
}
/*
* Main CacheCleaner window
*/
class CacheCleaner : public QMainWindow
{
Q_OBJECT
private:
Ui::CacheCleaner *ui;
PackageGroupModel *m_installed;
PackageGroupModel *m_uninstalled;
QTcpServer *m_tcpServer;
private slots:
void onSendInfoToOctopiHelper();
public:
explicit CacheCleaner(QWidget *parent = 0);
~CacheCleaner();
bool startServer();
protected:
void closeEvent(QCloseEvent *);
void keyPressEvent(QKeyEvent *);
};
#endif // CACHECLEANER_H

94
cachecleaner/main.cpp Normal file
View File

@@ -0,0 +1,94 @@
/*
Copyright 2015 Michaël Lhomme
This file is part of AppSet.
AppSet is free software; you can redistribute it and/or modify
it under the terms of the GNU General Public License as published by
the Free Software Foundation; either version 2 of the License, or
(at your option) any later version.
AppSet is distributed in the hope that it will be useful,
but WITHOUT ANY WARRANTY; without even the implied warranty of
MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
GNU General Public License for more details.
You should have received a copy of the GNU General Public License
along with AppSet; if not, write to the Free Software
Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
*/
#include "cachecleaner.h"
#include "../src/strconstants.h"
#include "../src/QtSolutions/qtsingleapplication.h"
#include <QApplication>
#include <QMessageBox>
#include <QTranslator>
#include <QLocale>
#include <QLibraryInfo>
#include <QtGui>
int main( int argc, char *argv[] )
{
unsetenv("TMPDIR");
QtSingleApplication app( QStringLiteral("Cache Cleaner - Octopi"), argc, argv );
//If there is already an instance running...
if (app.isRunning())
{
app.sendMessage(QStringLiteral("RAISE"));
return 0;
}
app.sendMessage(QStringLiteral("RAISE"));
QTranslator appTranslator;
bool success = appTranslator.load(QLatin1String(":/resources/translations/octopi_cachecleaner_") +
QLocale::system().name());
if (!success)
{
success = appTranslator.load(QStringLiteral(":/resources/translations/octopi_cachecleaner_en.qm"));
}
app.installTranslator(&appTranslator);
if (UnixCommand::isRootRunning()){
QMessageBox::critical( nullptr, StrConstants::getApplicationName(), StrConstants::getErrorRunningWithRoot());
return (-2);
}
if (!UnixCommand::hasTheExecutable(QStringLiteral("paccache")))
{
QMessageBox::critical( nullptr, StrConstants::getApplicationName(), StrConstants::getExecutableCouldNotBeFound().arg(QStringLiteral("\"paccache\"")));
return (-3);
}
if (!QFile::exists(ctn_OCTOPI_HELPER_PATH))
{
qDebug() << "Aborting cache-cleaner as 'octphelper' binary could not be found! [" << ctn_OCTOPI_HELPER_PATH << "]";
return (-4);
}
if (!QFile::exists(ctn_OCTOPISUDO))
{
qDebug() << "Aborting cache-cleaner as 'octopi-sudo' binary could not be found! [" << ctn_OCTOPISUDO << "]";
return (-5);
}
if (!UnixCommand::isOctoToolRunning(QStringLiteral("octopi-cachecleaner")))
{
QMessageBox::critical(nullptr, StrConstants::getApplicationName(), StrConstants::getErrorRunOctopiCacheCleanerAsUsrBin());
return (-6);
}
CacheCleaner w;
if (w.startServer())
{
app.setActivationWindow(&w);
w.show();
QResource::registerResource(QStringLiteral("./resources.qrc"));
return app.exec();
}
}

View File

@@ -0,0 +1,11 @@
[Desktop Entry]
Name=Octopi CacheCleaner
Icon=octopi
Exec=/usr/bin/octopi-cachecleaner
Terminal=false
Type=Application
Categories=GNOME;GTK;System;
#NotShowIn=GNOME;XFCE;LXDE;KDE;
StartupNotify=true
Version=1.5
SingleMainWindow=true

View File

@@ -0,0 +1,132 @@
#-------------------------------------------------
#
# Project created by QtCreator 2013-02-21T18:57:08
#
#-------------------------------------------------
QT += core gui network xml widgets
CONFIG += qt console warn_on debug
# Disable automatic string conversions
DEFINES += QT_USE_QSTRINGBUILDER \
QT_NO_CAST_FROM_ASCII \
QT_NO_CAST_TO_ASCII \
QT_NO_URL_CAST_FROM_STRING \
QT_NO_CAST_FROM_BYTEARRAY
TEMPLATE = app
DESTDIR += bin
OBJECTS_DIR += build
MOC_DIR += build
UI_DIR += build
HEADERS += cachecleaner.h \
packagegroupmodel.h \
../src/strconstants.h \
../src/qaesencryption.h \
../src/unixcommand.h \
../src/wmhelper.h \
../src/terminal.h \
../src/settingsmanager.h \
../src/searchlineedit.h \
../src/utils.h \
../src/package.h \
../src/QtSolutions/qtsingleapplication.h \
../src/QtSolutions/qtlocalpeer.h \
../src/QtSolutions/qtlockedfile.h \
../src/QtSolutions/qtsinglecoreapplication.h
SOURCES += main.cpp \
cachecleaner.cpp \
packagegroupmodel.cpp \
../src/strconstants.cpp \
../src/qaesencryption.cpp \
../src/unixcommand.cpp \
../src/wmhelper.cpp \
../src/terminal.cpp \
../src/settingsmanager.cpp \
../src/searchlineedit.cpp \
../src/utils.cpp \
../src/package.cpp \
../src/QtSolutions/qtsingleapplication.cpp \
../src/QtSolutions/qtlocalpeer.cpp \
../src/QtSolutions/qtlockedfile.cpp \
../src/QtSolutions/qtsinglecoreapplication.cpp
FORMS += ui/cachecleaner.ui
RESOURCES += resources.qrc
TRANSLATIONS += resources/translations/octopi_cachecleaner_pt_BR.ts \
resources/translations/octopi_cachecleaner_fr_FR.ts \
resources/translations/octopi_cachecleaner_fr.ts \
resources/translations/octopi_cachecleaner_es_ES.ts \
resources/translations/octopi_cachecleaner_es_419.ts \
resources/translations/octopi_cachecleaner_es_AR.ts \
resources/translations/octopi_cachecleaner_el.ts \
resources/translations/octopi_cachecleaner_de.ts \
resources/translations/octopi_cachecleaner_it.ts \
resources/translations/octopi_cachecleaner_ro.ts \
resources/translations/octopi_cachecleaner_tr_TR.ts \
resources/translations/octopi_cachecleaner_ar.ts \
resources/translations/octopi_cachecleaner_ca.ts \
resources/translations/octopi_cachecleaner_bg.ts \
resources/translations/octopi_cachecleaner_pl.ts \
resources/translations/octopi_cachecleaner_id.ts \
resources/translations/octopi_cachecleaner_da.ts \
resources/translations/octopi_cachecleaner_cs.ts \
resources/translations/octopi_cachecleaner_he.ts \
resources/translations/octopi_cachecleaner_hi.ts \
resources/translations/octopi_cachecleaner_hi_IN.ts \
resources/translations/octopi_cachecleaner_lt.ts \
resources/translations/octopi_cachecleaner_nb.ts \
resources/translations/octopi_cachecleaner_sr@latin.ts \
resources/translations/octopi_cachecleaner_sr_RS.ts \
resources/translations/octopi_cachecleaner_nl.ts \
resources/translations/octopi_cachecleaner_ru.ts \
resources/translations/octopi_cachecleaner_uz.ts \
resources/translations/octopi_cachecleaner_fi.ts \
resources/translations/octopi_cachecleaner_fi_FI.ts \
resources/translations/octopi_cachecleaner_vi.ts \
resources/translations/octopi_cachecleaner_en_GB.ts \
resources/translations/octopi_cachecleaner_pt_PT.ts \
resources/translations/octopi_cachecleaner_sv.ts \
resources/translations/octopi_cachecleaner_sl.ts \
resources/translations/octopi_cachecleaner_hu.ts \
resources/translations/octopi_cachecleaner_zh_TW.ts \
resources/translations/octopi_cachecleaner_ms_MY.ts \
resources/translations/octopi_cachecleaner_uk.ts \
resources/translations/octopi_cachecleaner_sk.ts \
resources/translations/octopi_cachecleaner_ja.ts \
resources/translations/octopi_cachecleaner_eu.ts \
resources/translations/octopi_cachecleaner_gl_ES.ts \
resources/translations/octopi_cachecleaner_ast.ts \
resources/translations/octopi_cachecleaner_hr.ts \
resources/translations/octopi_cachecleaner_zh-Hans.ts \
resources/translations/octopi_cachecleaner_zh_CN.ts \
resources/translations/octopi_cachecleaner_ko.ts \
resources/translations/octopi_cachecleaner_ko_KR.ts \
# install
isEmpty(PREFIX) {
PREFIX = /usr
}
isEmpty(BINDIR) {
BINDIR = $$PREFIX/bin
}
isEmpty(DATADIR) {
DATADIR = $$PREFIX/share
}
target.path = $$BINDIR
sources.files = $$SOURCES $$HEADERS $$RESOURCES $$FORMS *.pro
sources.path = .
desktop.path = $$DATADIR/applications
desktop.files += cachecleaner/octopi-cachecleaner.desktop
INSTALLS += target desktop

View File

@@ -0,0 +1,283 @@
/*
Copyright 2015 Michaël Lhomme
This file is part of AppSet.
AppSet is free software; you can redistribute it and/or modify
it under the terms of the GNU General Public License as published by
the Free Software Foundation; either version 2 of the License, or
(at your option) any later version.
AppSet is distributed in the hope that it will be useful,
but WITHOUT ANY WARRANTY; without even the implied warranty of
MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
GNU General Public License for more details.
You should have received a copy of the GNU General Public License
along with AppSet; if not, write to the Free Software
Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
*/
#include "packagegroupmodel.h"
#include "../src/strconstants.h"
#include <QSharedMemory>
#include <QApplication>
#include <QMessageBox>
/*
* Constructor
*
* @param listView The list view to display packages
* @param spinner The spinner to configure the number of archive to keep
* @param refreshBtn The refresh view button
* @param cleanBtn The clean button
*/
PackageGroupModel::PackageGroupModel(QString optionsString,
QListWidget *listView,
QSpinBox *spinner,
QPushButton *refreshBtn,
QPushButton *cleanBtn)
: QObject(nullptr),
m_optionsString(optionsString),
m_listView(listView),
m_spinner(spinner),
m_refreshButton(refreshBtn),
m_cleanButton(cleanBtn),
m_cmd(new UnixCommand(this)),
m_acc(new ProcessOutputAccumulator(m_cmd)),
m_oldKeepValue(spinner->value())
{
m_cleanButton->setText(tr("Clean"));
m_sharedMemory=new QSharedMemory(QStringLiteral("org.arnt.octopi"), this);
//setup UI slots
connect( m_spinner, SIGNAL( valueChanged(int) ), SLOT( updateKeepArchives() ) );
connect( m_spinner, SIGNAL( valueChanged(int) ), SLOT( refreshCacheView() ) );
connect( m_spinner, SIGNAL( editingFinished() ), SLOT( keepArchivesChanged() ) );
connect( m_refreshButton, SIGNAL( clicked() ), SLOT( refreshCacheView() ) );
connect( m_cleanButton, SIGNAL( clicked() ), SLOT( cleanCache() ) );
isExecutingCommand = false;
//refresh cache informations at startup
refreshCacheView();
}
/*
* Destructor
*/
PackageGroupModel::~PackageGroupModel()
{
//UnixCommand::removeSharedMemFiles();
delete m_acc;
delete m_cmd;
}
/*
* Handle spinner change: disable the clean button
* to ensure consistency between the list and what
* will effectively be cleared if the user press
* the button
*/
void PackageGroupModel::updateKeepArchives()
{
m_cleanButton->setEnabled(false);
}
/*
* Refresh the cache when the spinner change are validated
*/
void PackageGroupModel::keepArchivesChanged()
{
if(m_spinner->value() != m_oldKeepValue)
refreshCacheView();
}
/*
* Return the options to pass to paccache according to the current context
*/
QString PackageGroupModel::getOptions()
{
return QStringLiteral("%1-k %2").arg(m_optionsString).arg(m_spinner->value());
}
/*
* Refresh the view
*/
void PackageGroupModel::refreshCacheView()
{
if (isExecutingCommand) return;
//update UI for background refresh
QApplication::setOverrideCursor(Qt::WaitCursor);
m_acc->reset();
m_refreshButton->setEnabled(false);
m_cleanButton->setEnabled(false);
m_listView->clear();
m_oldKeepValue = m_spinner->value();
//connect handler slot and call the command
QObject::connect(m_cmd, SIGNAL( finished ( int, QProcess::ExitStatus )),
this, SLOT( finishedDryrun ( int, QProcess::ExitStatus )) );
QStringList sl;
sl << QStringLiteral("-v");
sl << QStringLiteral("-d");
QStringList opt = getOptions().split(QStringLiteral(" "), Qt::SkipEmptyParts);
sl << opt;
m_cmd->executeCommandAsNormalUser(QStringLiteral("/usr/bin/paccache"), sl);
isExecutingCommand = true;
}
/*
* Checks if some SU utility is available...
* Returns false if not!
*/
bool PackageGroupModel::isSUAvailable()
{
//If there are no means to run the actions, we must warn!
if (UnixCommand::isRootRunning() && WMHelper::isKDERunning())
{
return true;
}
else if (WMHelper::getSUCommand() == ctn_NO_SU_COMMAND){
QMessageBox::critical( nullptr, StrConstants::getApplicationName(),
StrConstants::getErrorNoSuCommand() +
QLatin1String("\n") + StrConstants::getYoullNeedSuFrontend());
return false;
}
else
return true;
}
/*
* Call paccache to effectively clear the cache
*/
void PackageGroupModel::cleanCache()
{
if (isExecutingCommand || UnixCommand::isPacmanDbLocked()){
QMessageBox::critical( nullptr, StrConstants::getApplicationName(),
StrConstants::getErrorDbLock());
return;
}
if (!isSUAvailable())
return;
//update UI buttons
QApplication::setOverrideCursor(Qt::WaitCursor);
m_acc->reset();
m_refreshButton->setEnabled(false);
m_cleanButton->setEnabled(false);
//connect handler slot and call the command
QObject::connect(m_cmd, SIGNAL( finished ( int, QProcess::ExitStatus )),
this, SLOT( finishedClean( int, QProcess::ExitStatus )) );
isExecutingCommand = true;
const QString tmp = QLatin1String("paccache -r ") + getOptions();
//UnixCommand::removeTemporaryFiles();
m_cmd->executeCommandWithSharedMemHelper(tmp, m_sharedMemory);
}
/*
* Handle the result of the refresh action
*/
void PackageGroupModel::finishedDryrun(int exitCode, QProcess::ExitStatus)
{
//disconnect the handler
QObject::disconnect(m_cmd, SIGNAL( finished ( int, QProcess::ExitStatus )),
this, SLOT( finishedDryrun ( int, QProcess::ExitStatus )) );
QApplication::restoreOverrideCursor();
isExecutingCommand = false;
if(exitCode > 1)
{
//process failed, provide info on errors
QMessageBox::critical(m_listView, QStringLiteral("Error with the underlying process"), m_acc->getErrors());
}
else if (exitCode == 0)
{
//process finished successfully, process the resulting output
processDryrunResult(m_acc->getOutput());
}
//in either case, reenable the refresh button
m_refreshButton->setEnabled(true);
}
/*
* Handle the result of the clean action
*/
void PackageGroupModel::finishedClean(int exitCode, QProcess::ExitStatus)
{
//disconnect the handler
QObject::disconnect(m_cmd, SIGNAL( finished ( int, QProcess::ExitStatus ) ),
this, SLOT( finishedClean(int, QProcess::ExitStatus ) ) );
QApplication::restoreOverrideCursor();
isExecutingCommand = false;
if(exitCode != 0)
{
//process failed, return to main window
m_refreshButton->setEnabled(true);
m_cleanButton->setEnabled(true);
}
else
{
//refresh the view
refreshCacheView();
}
}
/*
* Process the output of the refresh commands
*
* @param output The output of the dryrun process
*/
void PackageGroupModel::processDryrunResult(QString output) {
QStringList lines = output.split(QRegularExpression(QStringLiteral("\\n")), Qt::SkipEmptyParts);
if(lines.length() == 1 || output.contains(QLatin1String("*.pkg.tar?(.+([^.]))")))
{
//"==> no candidate packages found for pruning"
m_cleanButton->setText(tr("Clean"));
}
else
{
//process package list
for(int i = 0; i < lines.length(); i++)
{
const QString& line = lines.at(i);
if(i == 0)
//skip the first line ("==> Candidate packages:")
continue;
else if(i == lines.length() - 1)
{
//extract size from "==> finished dry run: 8 candidates (disk space saved: 19.11 MiB)")
QStringList components = line.split(QStringLiteral(" "));
QString unit = components.takeLast();
unit.remove(unit.length() - 1, 1);
QString size = components.takeLast();
m_cleanButton->setText(tr("Clean %1").arg(QLatin1Char(' ') + size + QLatin1Char(' ') + unit));
}
else
m_listView->addItem(line);
}
//there is packages to clean so reenable the clean button
m_cleanButton->setEnabled(true);
}
}

View File

@@ -0,0 +1,114 @@
/*
Copyright 2015 Michaël Lhomme
This file is part of AppSet.
AppSet is free software; you can redistribute it and/or modify
it under the terms of the GNU General Public License as published by
the Free Software Foundation; either version 2 of the License, or
(at your option) any later version.
AppSet is distributed in the hope that it will be useful,
but WITHOUT ANY WARRANTY; without even the implied warranty of
MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
GNU General Public License for more details.
You should have received a copy of the GNU General Public License
along with AppSet; if not, write to the Free Software
Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
*/
#ifndef PACKAGEGROUP_H
#define PACKAGEGROUP_H
#include <QObject>
#include <QSpinBox>
#include <QListWidget>
#include <QPushButton>
#include "../src/unixcommand.h"
#include "../src/wmhelper.h"
/*
* Helper class to accumulate UnixCommand standard and error output
* on the fly
*/
class ProcessOutputAccumulator : QObject
{
Q_OBJECT
public:
ProcessOutputAccumulator(UnixCommand *cmd) {
m_unixCommand = cmd;
//connect(m_unixCommand, SIGNAL( started() ), SLOT( reset() ) );
connect(m_unixCommand, SIGNAL( readyReadStandardOutput() ), SLOT( standardOutputAvailable() ) );
connect(m_unixCommand, SIGNAL( readyReadStandardError() ), SLOT( errorsOutputAvailable() ) );
}
QString getOutput() { return m_standardOutput; }
QString getErrors() { return m_errorsOutput; }
public slots:
void reset()
{
m_standardOutput.clear();
m_errorsOutput.clear();
}
void standardOutputAvailable()
{
m_standardOutput.append(m_unixCommand->readAllStandardOutput());
}
void errorsOutputAvailable()
{
m_errorsOutput.append(m_unixCommand->readAllStandardError());
}
protected:
UnixCommand *m_unixCommand;
QString m_standardOutput;
QString m_errorsOutput;
};
/*
* Wrapper to encapsulate operation on package groups (installed and uninstalled)
*/
class PackageGroupModel : public QObject
{
Q_OBJECT
private:
bool isSUAvailable();
QSharedMemory *m_sharedMemory;
public:
PackageGroupModel(QString, QListWidget *, QSpinBox *, QPushButton *, QPushButton *);
~PackageGroupModel();
bool isExecutingCommand;
protected:
QString m_optionsString;
QListWidget *m_listView;
QSpinBox *m_spinner;
QPushButton *m_refreshButton;
QPushButton *m_cleanButton;
UnixCommand *m_cmd;
ProcessOutputAccumulator *m_acc;
int m_oldKeepValue;
void processDryrunResult(QString);
QString getOptions();
public slots:
void refreshCacheView();
void cleanCache();
void updateKeepArchives();
void keepArchivesChanged();
void finishedDryrun(int, QProcess::ExitStatus);
void finishedClean(int, QProcess::ExitStatus);
};
#endif // PACKAGEGROUP_H

View File

@@ -0,0 +1,54 @@
<RCC>
<qresource prefix="/">
<file>resources/images/cachecleaner.png</file>
<file>resources/translations/octopi_cachecleaner_ar.qm</file>
<file>resources/translations/octopi_cachecleaner_ast.qm</file>
<file>resources/translations/octopi_cachecleaner_bg.qm</file>
<file>resources/translations/octopi_cachecleaner_ca.qm</file>
<file>resources/translations/octopi_cachecleaner_cs.qm</file>
<file>resources/translations/octopi_cachecleaner_da.qm</file>
<file>resources/translations/octopi_cachecleaner_de.qm</file>
<file>resources/translations/octopi_cachecleaner_el.qm</file>
<file>resources/translations/octopi_cachecleaner_en_GB.qm</file>
<file>resources/translations/octopi_cachecleaner_en.qm</file>
<file>resources/translations/octopi_cachecleaner_es_419.qm</file>
<file>resources/translations/octopi_cachecleaner_es_AR.qm</file>
<file>resources/translations/octopi_cachecleaner_es_ES.qm</file>
<file>resources/translations/octopi_cachecleaner_eu.qm</file>
<file>resources/translations/octopi_cachecleaner_fi.qm</file>
<file>resources/translations/octopi_cachecleaner_fi_FI.qm</file>
<file>resources/translations/octopi_cachecleaner_fr_FR.qm</file>
<file>resources/translations/octopi_cachecleaner_fr.qm</file>
<file>resources/translations/octopi_cachecleaner_he.qm</file>
<file>resources/translations/octopi_cachecleaner_hi.qm</file>
<file>resources/translations/octopi_cachecleaner_hi_IN.qm</file>
<file>resources/translations/octopi_cachecleaner_hu.qm</file>
<file>resources/translations/octopi_cachecleaner_id.qm</file>
<file>resources/translations/octopi_cachecleaner_it.qm</file>
<file>resources/translations/octopi_cachecleaner_ja.qm</file>
<file>resources/translations/octopi_cachecleaner_lt.qm</file>
<file>resources/translations/octopi_cachecleaner_ms_MY.qm</file>
<file>resources/translations/octopi_cachecleaner_nb.qm</file>
<file>resources/translations/octopi_cachecleaner_nl.qm</file>
<file>resources/translations/octopi_cachecleaner_pl.qm</file>
<file>resources/translations/octopi_cachecleaner_pt_BR.qm</file>
<file>resources/translations/octopi_cachecleaner_pt_PT.qm</file>
<file>resources/translations/octopi_cachecleaner_ro.qm</file>
<file>resources/translations/octopi_cachecleaner_ru.qm</file>
<file>resources/translations/octopi_cachecleaner_sk.qm</file>
<file>resources/translations/octopi_cachecleaner_sr@latin.qm</file>
<file>resources/translations/octopi_cachecleaner_sr_RS.qm</file>
<file>resources/translations/octopi_cachecleaner_sv.qm</file>
<file>resources/translations/octopi_cachecleaner_sl.qm</file>
<file>resources/translations/octopi_cachecleaner_tr_TR.qm</file>
<file>resources/translations/octopi_cachecleaner_tr.qm</file>
<file>resources/translations/octopi_cachecleaner_uk.qm</file>
<file>resources/translations/octopi_cachecleaner_uz.qm</file>
<file>resources/translations/octopi_cachecleaner_vi.qm</file>
<file>resources/translations/octopi_cachecleaner_zh_TW.qm</file>
<file>resources/translations/octopi_cachecleaner_zh-Hans.qm</file>
<file>resources/translations/octopi_cachecleaner_zh_CN.qm</file>
<file>resources/translations/octopi_cachecleaner_hr.qm</file>
<file>resources/translations/octopi_cachecleaner_ko.qm</file>
</qresource>
</RCC>

Binary file not shown.

After

Width:  |  Height:  |  Size: 827 B

Binary file not shown.

After

Width:  |  Height:  |  Size: 1.2 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 1.2 KiB

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="af" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="af_ZA" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="ar" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>منظف الكاش - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>حزم غير مثبتة</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>إحتفظ:</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation>عدد النُسخ القديمة للإبقاء عليها</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>تحديث</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>حزم مثبتة</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>مسح</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>إمسح %1</translation>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="ast" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Llimpiador de la caché - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Paquetes desinstalaos</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>Caltener:</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation>Númberu de versiones vieyes a caltener</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Refrescar</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>Paquetes instalaos</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>Llimpiar</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>Llimpiar %1</translation>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="be" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="be_BY" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="bg" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Почистване на кеша - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Премахнати пакети</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>Запази :</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation>Брой на старите версии за запазване</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Опресняване</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>Инсталирани пакети</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>Почистване</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>Почистване на %1</translation>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="bs" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="bs_BA" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Keš čistač - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Deinstalirani paketi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>Zadrži</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation>Zadržati broj starih verzija</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Osvježi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>Instalirani paketi</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>Očisti</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>Očisti %1</translation>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="ca" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Netejador de la cau - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Paquets desinstal·lats</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>Mantén:</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation>Quantitat de versions antigues a mantenir:</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Refresca</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>Paquets instal·lats</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>Neteja</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>Neteja %1</translation>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="cmn" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="cs" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Čistič vyrovnávací paměti</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Odinstalované balíčky</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>Zachovat :</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation>Počet starých verzí k zachování</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Obnovit</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>Nainstalované balíčky</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>Vyčistit</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>Vyčistit %1</translation>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="cs_CZ" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="da" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Cache-renser - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Afinstallerede pakker</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>Behold :</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation>Antal gamle versioner der skal beholdes</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Genopfrisk</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>Installerede pakker</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>Rens</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>Rens %1</translation>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="de" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Zwischenspeicher säubern - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Deinstallierte Pakete</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>Behalten:</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation>Anzahl der alten Versionen, die behalten werden: </translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Aktualisieren</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>Installierte Pakete</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>Säubern</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>Säubere %1</translation>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="de_AT" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="de_DE" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="el" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Καθαριστικό μνήμης cache - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Μη εγκατεστημένα πακέτα</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>Διατηρηση:</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation>Αριθμός των παλαιών εκδόσεων για διατηρηση</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Ανανέωση</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>Εγκατεστημένα πακέτα</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>Εκκαθαριση</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>Εκκαθαριση %1</translation>
</message>
</context>
</TS>

View File

@@ -0,0 +1,55 @@
<?xml version="1.0" encoding="utf-8"?>
<!DOCTYPE TS>
<TS version="2.1" language="en_US">
<context>
<name>CacheCleaner</name>
<message>
<location filename="../../ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"></translation>
</message>
<message>
<location filename="../../ui/cachecleaner.ui" line="31"/>
<source>Uninstalled packages</source>
<translation type="unfinished"></translation>
</message>
<message>
<location filename="../../ui/cachecleaner.ui" line="42"/>
<source>Keep : </source>
<translation type="unfinished"></translation>
</message>
<message>
<location filename="../../ui/cachecleaner.ui" line="65"/>
<location filename="../../ui/cachecleaner.ui" line="134"/>
<source>Refresh</source>
<translation type="unfinished"></translation>
</message>
<message>
<location filename="../../ui/cachecleaner.ui" line="72"/>
<location filename="../../ui/cachecleaner.ui" line="141"/>
<location filename="../../cachecleaner.cpp" line="282"/>
<source>Clean</source>
<translation type="unfinished"></translation>
</message>
<message>
<location filename="../../ui/cachecleaner.ui" line="90"/>
<source>Installed packages</source>
<translation type="unfinished"></translation>
</message>
<message>
<location filename="../../ui/cachecleaner.ui" line="101"/>
<source>Keep :</source>
<translation type="unfinished"></translation>
</message>
<message>
<location filename="../../ui/cachecleaner.ui" line="108"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"></translation>
</message>
<message>
<location filename="../../cachecleaner.cpp" line="303"/>
<source>Clean </source>
<translation type="unfinished"></translation>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="en_CZ" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="en_GB" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Cache Cleaner - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Uninstalled packages</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>Keep :</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation>Number of old versions to keep</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Refresh</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>Installed packages</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>Clean</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>Clean %1</translation>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="en_IN" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="en_PL" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="en_SE" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="eo" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Malinstalitaj Pakaĵoj</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>Konservi :</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Refreŝigi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>Instalitaj Pakaĵoj</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>Purigi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>Purigi %1</translation>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="es" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Limpiador de caché</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Paquetes desinstalados</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>Mantener:</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation>Número de versiones antiguas a mantener</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Refrescar</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>Paquetes instalados</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>Limpiar</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>Limpiar %1</translation>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="es_419" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Limpiador de Cache - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Paquetes desinstalados</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>Mantener :</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation>Número de versión anterior a mantener</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Actualizar</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>Paquetes instalados</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>Limpiar</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>Limpiar %1</translation>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="es_AR" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Limpiador de Caché - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Paquetes desinstalados</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>Conservar:</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation>Número de versiones antiguas para conservar</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Refrescar</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>Paquetes instalados</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>Limpiar</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>Limpiar %1</translation>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="es_CL" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Limpiador Cache-Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Paquetes desinstalados</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>Mantener :</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation>Número de versiones anteriores a mantener</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Refrescar</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>Paquetes instalados</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>Limpiar</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>Limpiar %1</translation>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="es_CR" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="es_ES" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Limpiador de Caché - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Paquetes desinstalados</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>Conservar :</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation>Número de versiones antiguas a conservar:</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Refrescar</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>Paquetes instalados</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>Limpiar</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>Limpiar %1</translation>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="es_MX" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Limpiador de Caché - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Paquetes desinstalados</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>Conservar:</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation>Número de versión anterior a conservar</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Actualizar</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>Paquetes instalados</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>Limpiar</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>Limpiar %1</translation>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="es_NI" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="es_PE" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Borrar Cache - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Refrescar</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>Borrar</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="eu" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Cache Garbitzailea - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Ezabatutako paketeak</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>Mantendu :</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation>Zenbat bertsio zahar mantendu</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Eguneratu</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>Instalatutako paketeak</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>Garbitu</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>%1 Garbitu</translation>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="fa_IR" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Cache Cleaner - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>بسته های حذف شده</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>نگهداری</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation>تعداد ورژنهایی که باقی میمانند</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>تازه سازی</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>بسته های نصب شده</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>تمیز کردن</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>پاک کردن 1%</translation>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="fi" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Välimuistin tyhjennys - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Asentamattomat paketit</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>Säilytä:</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation>Säilytettävien vanhojen versioiden määrä</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Päivitä</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>Asennetut paketit</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>Tyhjennä</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>Tyhjennä %1</translation>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="fi_FI" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Välimuistin tyhjennys - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Asentamattomat paketit</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>Säilytä:</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation>Säilytettävien vanhojen versioiden lukumäärä</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Päivitä</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>Asennetut paketit</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>Tyhjennä</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>Tyhjennä %1</translation>
</message>
</context>
</TS>

Some files were not shown because too many files have changed in this diff Show More