537 Commits

Author SHA1 Message Date
Alexandre Arnt
6341f8ad9e - Bugfix in refresh 2025-10-18 11:03:08 -03:00
Alexandre Arnt
8afef025a7 - Updated tx 2025-10-18 09:59:40 -03:00
Alexandre Arnt
22791cdbda Updated tx 2025-10-17 20:14:59 -03:00
Alexandre Arnt
d8b4782142 - Change UI option name 2025-10-17 18:37:40 -03:00
Alexandre Arnt
d333d47760 Updated tx 2025-10-17 18:16:17 -03:00
Alexandre Arnt
5540fa8c1b New screenshot 2025-10-17 14:18:40 -03:00
Alexandre Arnt
252fce719c - Small fixes 2025-10-13 13:28:22 -03:00
Alexandre Arnt
572bdabc3b Bugfix in check updates 2025-10-11 16:04:55 -03:00
Alexandre Arnt
45c472ae29 - Bugfix in AUR outdated list 2025-10-11 15:38:42 -03:00
Alexandre Arnt
e4482c4be8 - Bugfixes 2025-10-11 15:33:48 -03:00
Alexandre Arnt
bb7cbee491 - Bugfixes 2025-10-11 11:35:00 -03:00
Alexandre Arnt
9f97fa93af - Bugfixes 2025-10-11 10:22:56 -03:00
Alexandre Arnt
f406cacd91 - Bugfix 2025-10-10 22:14:18 -03:00
Alexandre Arnt
9ea4e2ced0 - bugfix 2025-10-10 22:04:03 -03:00
Alexandre Arnt
219539db7c - Bugfix 2025-10-10 21:55:00 -03:00
Alexandre Arnt
d704996a71 - Make checkupdates available in AUR mode 2025-10-10 21:43:00 -03:00
Alexandre Arnt
cb555b10fa - Condensed text fixes 2025-10-10 16:14:27 -03:00
Alexandre Arnt
02d0413706 Updated CHANGELOG 2025-10-09 14:35:55 -03:00
Alexandre Arnt
eba4b23398 Updated tx 2025-10-09 14:32:53 -03:00
Alexandre Arnt
3509f956d1 - Add the option to make the whole interface text less condensed. 2025-10-09 14:30:55 -03:00
Alexandre Arnt
133a32d1bb Updated changelog 2025-10-09 10:32:00 -03:00
Alexandre Arnt
a7846c9318 Merge pull request #607 from valchx/valchx/show-current-version-on-system-updates
Show current version of the packages on the System Upgrade window
2025-10-09 10:28:39 -03:00
Alexandre Arnt
97dbbb0e28 - Parser fix 2025-10-08 18:33:43 -03:00
Alexandre Arnt
8ec0c319e4 - BugFix in getting news 2025-10-08 17:59:13 -03:00
Valentin Charoux
99ae4eea09 show current version of package on system update 2025-10-08 22:14:20 +02:00
Alexandre Arnt
7ef564da38 - 0.19... 2025-10-08 17:10:26 -03:00
Alexandre Arnt
46c163548c - Use terminal font in output dialog 2025-10-08 17:06:04 -03:00
Alexandre Arnt
2cebca86ba - BugFix: There was a method called more than once every time distro
news was checked.
2025-10-08 16:44:18 -03:00
Alexandre Arnt
19bff087c8 - BugFix: Octopi crashed after using AUR/KCP tool and clicking on a
package anchor in Output tab.
2025-10-08 15:23:52 -03:00
Alexandre Arnt
a6c6384888 - Add Repository field in Info tab. 2025-10-08 14:52:37 -03:00
Alexandre Arnt
8c89906b21 - Add the option to show/hide "Repository" and "Download Size" columns
in package list.
2025-10-08 14:07:57 -03:00
Alexandre Arnt
6c9af10ef0 - Text spacing fixes 2025-10-08 11:27:15 -03:00
Alexandre Arnt
46bbc195a0 updated tx 2025-10-08 09:46:39 -03:00
Alexandre Arnt
73c7f7cfb8 Updated tx 2025-10-04 09:59:37 -03:00
Alexandre Arnt
6f35213ecc - BugFix: Some outdated AUR pkgs were not showing on notifier (thanks to
urbenlegend).
2025-10-04 09:33:40 -03:00
Alexandre Arnt
97c11f0f10 BugFix: Let's not get a description as a pkgname 2025-10-03 17:57:05 -03:00
Alexandre Arnt
dec6656a44 UI changes 2025-10-03 15:21:14 -03:00
Alexandre Arnt
0875030993 - BugFix: Search for BASH also in "/bin". 2025-09-29 17:47:12 -03:00
Alexandre Arnt
4fd9bc265c - BugFix: Under some conditions Octopi could crash due to shared memory
access failures.
2025-09-29 17:28:04 -03:00
Alexandre Arnt
8781695048 Merge branch 'master' of https://github.com/aarnt/octopi 2025-09-28 20:54:20 -03:00
Alexandre Arnt
4fa4562e65 - Parser fixes 2025-09-28 20:54:07 -03:00
Alexandre Arnt
196e282924 - BugFix: List of outdated KCP packages was not working in KaOS. 2025-09-28 18:17:17 -03:00
Alexandre Arnt
3fc49cb3aa Parser fix 2025-09-28 17:16:47 -03:00
Alexandre Arnt
ab31f28308 Release prep 2025-09-28 16:30:06 -03:00
Alexandre Arnt
dc23455cce Release prep 2025-09-28 16:14:20 -03:00
Alexandre Arnt
51f4d66d1a - BugFix: Force use of BASH shell was not working (thanks to
UnsaltedScholar).
2025-09-28 15:59:44 -03:00
Alexandre Arnt
7aef1f07f8 - Important bugfixes 2025-09-28 12:52:48 -03:00
Alexandre Arnt
1ff216543d Bugfix in french tx 2025-09-28 11:11:12 -03:00
Alexandre Arnt
275655ff61 new dev cycle 2025-09-26 14:10:20 -03:00
Alexandre Arnt
5fefb275c2 Updated tx 2025-09-25 17:29:50 -03:00
Alexandre Arnt
6466b3604f Release prep 2025-09-20 15:30:00 -03:00
Alexandre Arnt
93726ee571 Updated tx and README 2025-09-16 19:22:25 -03:00
Alexandre Arnt
0146c29419 - Parser fix 2025-09-15 18:04:11 -03:00
Alexandre Arnt
e54977c340 - new screenshot 2025-09-15 17:46:39 -03:00
Alexandre Arnt
5b3bc51990 - BugFix in helper 2025-09-15 17:16:22 -03:00
Alexandre Arnt
7b365a1f14 - Disable About from Notifier 2025-09-15 16:53:26 -03:00
Alexandre Arnt
e4fdedaf33 - Bugfixes 2025-09-15 16:13:53 -03:00
Alexandre Arnt
848239572d - BugFix in parser 2025-09-15 15:40:32 -03:00
Alexandre Arnt
e1d9e85945 - BugFix in parser code. 2025-09-15 15:29:04 -03:00
Alexandre Arnt
42a7c320d9 - BugFix in enable/disable UI 2025-09-15 14:54:31 -03:00
Alexandre Arnt
d03b5a84d0 Bugfix 2025-09-15 11:37:37 -03:00
Alexandre Arnt
1e6b2db303 Changed resource name 2025-09-14 08:54:28 -03:00
Alexandre Arnt
a6785e9b7c Changed resource name 2025-09-14 08:50:00 -03:00
Alexandre Arnt
c25ed66c0c - BugFix in search method save logic 2025-09-12 11:24:15 -03:00
Alexandre Arnt
4df0d961e6 Add octopi icon 2025-09-12 10:43:19 -03:00
Alexandre Arnt
aea5e70748 - BugFix 2025-09-11 20:19:20 -03:00
Alexandre Arnt
e9136182c9 - Bugfix 2025-09-11 20:09:46 -03:00
Alexandre Arnt
86288068fa - Added support for garuda-update command when running in Garuda Linux. 2025-09-11 18:51:49 -03:00
Alexandre Arnt
331bec30c8 Added pre-system-upgrade example script 2025-09-11 17:42:10 -03:00
Alexandre Arnt
7cae2d7586 Updated tx 2025-09-11 15:56:34 -03:00
Alexandre Arnt
1b202a25f8 Updated tx 2025-09-11 14:35:22 -03:00
Alexandre Arnt
fae056ec81 - Search option selected by the user is saved on close. 2025-09-10 20:13:48 -03:00
Alexandre Arnt
9dcf3ed14d Updated tx 2025-09-10 09:10:04 -03:00
Alexandre Arnt
f19e55220e - Updated tx 2025-09-08 18:21:02 -03:00
Alexandre Arnt
6938c1f833 - Bugfix in context menu 2025-09-08 18:17:38 -03:00
Alexandre Arnt
7208096fdc - Bugfixes in KCP code 2025-09-08 17:49:16 -03:00
Alexandre Arnt
c4a9677667 Bugfix 2025-09-08 17:11:17 -03:00
Alexandre Arnt
0993cda3a0 - Updated tx 2025-09-08 16:52:52 -03:00
Alexandre Arnt
8bed4c0e46 - Bugfix 2025-09-08 16:14:12 -03:00
Alexandre Arnt
9fdd1a5e89 - bugfix 2025-09-08 16:10:37 -03:00
Alexandre Arnt
1cb421c284 - Added View/Ignored menu option. 2025-09-08 15:29:05 -03:00
Alexandre Arnt
20c2472aa1 Updated screenshot 2025-09-05 18:09:46 -03:00
Alexandre Arnt
dcb99d28ec - Release preparation 2025-09-05 17:40:16 -03:00
Alexandre Arnt
d7e103388a Updated tx 2025-09-05 17:23:36 -03:00
Alexandre Arnt
1ec036202b Updated tx 2025-09-04 17:17:30 -03:00
Alexandre Arnt
a783507d60 Updated tx 2025-09-04 13:04:39 -03:00
Alexandre Arnt
b2c82af9f4 Updated tx 2025-09-04 09:57:38 -03:00
Alexandre Arnt
aaf1e5f6d6 - Bugfix in KaOS rss 2025-09-01 18:46:09 -03:00
Alexandre Arnt
197398e3bc - Bugfix 2025-09-01 18:38:39 -03:00
Alexandre Arnt
38308ac0d0 - Update KaOS rss url 2025-09-01 18:33:03 -03:00
Alexandre Arnt
e0e97795f3 - BugFix 2025-09-01 14:21:18 -03:00
Alexandre Arnt
0b02c78704 - Bugfix in helper 2025-09-01 14:06:27 -03:00
Alexandre Arnt
c7f101f67f Release prep 2025-09-01 13:54:20 -03:00
Alexandre Arnt
ee70dc46a2 - Bugfix 2025-09-01 10:00:28 -03:00
Alexandre Arnt
aafa8522ea Updated tx 2025-09-01 09:25:13 -03:00
Alexandre Arnt
b9b4913bbc Updated tx 2025-08-31 16:50:24 -03:00
Alexandre Arnt
cdc2013cbb - Updated tx 2025-08-29 17:53:30 -03:00
Alexandre Arnt
04adf88088 - Updated tx 2025-08-29 17:50:55 -03:00
Alexandre Arnt
a1d064fbe0 - Updated tx 2025-08-29 17:49:32 -03:00
Alexandre Arnt
150763f0e3 - Added another cmd 2025-08-29 16:37:51 -03:00
Alexandre Arnt
c3afa378d1 - Added support for a user specified backup shell script that needs to
be placed at "/usr/lib/octopi/pre-system-upgrade-script.sh" and executes
before the system upgrades.
2025-08-29 16:00:14 -03:00
Alexandre Arnt
70b8bc97ae - Bugfixes in options dialog. 2025-08-29 11:30:18 -03:00
Alexandre Arnt
256e862382 - Added "Get Latest distro news" menu item to the News tab context menu. 2025-08-29 11:06:04 -03:00
Alexandre Arnt
569e5fe133 - Bugfix 2025-08-29 10:57:34 -03:00
Alexandre Arnt
0d7dd83354 - Added support for Plus and Minus keys to add and remove packages from
the system.
2025-08-29 10:18:37 -03:00
Alexandre Arnt
241ae97423 - Bugfix 2025-08-29 10:00:30 -03:00
Alexandre Arnt
11867b1ee6 - Added support for pacman.conf's IgnorePkg option through "Add to
Ignored" and "Remove from Ignored" actions from the context menu in the
package list.
2025-08-29 09:53:01 -03:00
Alexandre Arnt
603c477ef0 - Initial support for IgnorePkg 2025-08-28 16:00:49 -03:00
Alexandre Arnt
be52ee78a7 - BugFix: Use system theme folder icon in Files tab.
- BugFix: Package list refresh was not running after a group install/
removal.
2025-08-25 19:55:36 -03:00
Alexandre Arnt
840aef9bb9 - Added Apply and Cancel buttons also in the Actions tab. 2025-08-25 17:53:11 -03:00
Alexandre Arnt
dfeb189940 - Updated tx 2025-08-25 13:07:30 -03:00
Alexandre Arnt
07161db266 - BugFix: Make Actions tab visible when a package is selected for
insertion/removal.
2025-08-25 10:55:54 -03:00
Alexandre Arnt
77f6ea88aa - Bugfix 2025-08-25 10:32:08 -03:00
Alexandre Arnt
139950ab25 - BugFix: select Help tab when Octopi runs for the first time. 2025-08-25 10:01:36 -03:00
Alexandre Arnt
c22834118c - BugFix: Use user-selected search option while octopi is running. 2025-08-24 20:23:13 -03:00
Alexandre Arnt
e156b543f5 - Added Tools/pacman-key option to refresh pacman gpg keys. 2025-08-24 18:36:19 -03:00
Alexandre Arnt
4d3278567b - Bugfix 2025-08-24 16:48:33 -03:00
Alexandre Arnt
ce66ccbf03 - Modernization of Options dialog. 2025-08-24 16:36:03 -03:00
Alexandre Arnt
f83f596ce8 Updated tx 2025-08-24 10:30:57 -03:00
Alexandre Arnt
9c047a024c - Debug for pkg contents size 2025-08-22 17:58:12 -03:00
Alexandre Arnt
d4a32751f3 - new defaults 2025-08-22 15:53:03 -03:00
Alexandre Arnt
ab9f709dc2 - Fix icons dir 2025-08-22 13:44:52 -03:00
Alexandre Arnt
bcb2217f49 Updated tx 2025-08-22 13:29:52 -03:00
Alexandre Arnt
dce264509f - Removed unused code and added test code. 2025-08-22 13:25:15 -03:00
Alexandre Arnt
927f208f78 - Bugfix 2025-08-22 11:43:43 -03:00
Alexandre Arnt
93b42b40d4 - Log 2025-08-22 11:40:32 -03:00
Alexandre Arnt
3184a4b17e - Bugfix 2025-08-22 11:32:26 -03:00
Alexandre Arnt
18b4d36f85 - Bugfix in code. 2025-08-22 11:24:21 -03:00
Alexandre Arnt
4c7f7e2b09 - Bugfix in code. 2025-08-22 10:29:06 -03:00
Alexandre Arnt
faa80775a5 - Fix tool name 2025-08-22 10:25:10 -03:00
Alexandre Arnt
7ab4e7fce5 - Adjust for new code. 2025-08-22 10:06:54 -03:00
Alexandre Arnt
cc105bf2e1 - BugFix: Use better way to detect if user is running the tools from the
right place.
2025-08-22 09:44:05 -03:00
Alexandre Arnt
367e8ad750 Updated tx 2025-08-22 09:11:45 -03:00
Alexandre Arnt
6892f5f3c1 - bugfix 2025-08-21 20:13:04 -03:00
Alexandre Arnt
b23353a1f5 - Added CachyOS options. 2025-08-21 20:10:37 -03:00
Alexandre Arnt
9986b1a2cb Updated tx 2025-08-21 18:57:28 -03:00
Alexandre Arnt
4d67fa44e4 Updated tx 2025-08-21 18:21:45 -03:00
Alexandre Arnt
993b95420f - BugFix: qt-sudo now respects user locale settings. 2025-08-21 16:52:00 -03:00
Alexandre Arnt
f4462b9379 - Added "Enable package tooltips" option, so users can disable the
feature when needed.
- Added "Force use of BASH shell" option to ensure compatibility when
the user uses another SHELL.
2025-08-21 15:34:25 -03:00
Alexandre Arnt
c43d148dd7 - Removed debug msg. 2025-08-21 14:29:22 -03:00
Alexandre Arnt
a508fb7b11 - Removed buggy strings. 2025-08-21 14:23:47 -03:00
Alexandre Arnt
6590909116 - Removed non working test. 2025-08-21 14:07:16 -03:00
Alexandre Arnt
44df329672 Merge branch 'master' of https://github.com/aarnt/octopi 2025-08-11 13:59:25 -03:00
Alexandre Arnt
96896f8a87 Updated tx 2025-08-11 13:59:16 -03:00
Alexandre Arnt
448c620c8a Updated README file 2025-05-30 15:46:08 -03:00
Alexandre Arnt
2ec8dbde08 Updated tx 2025-05-25 08:39:09 -03:00
Alexandre Arnt
48fc54d24b - BugFix: Notifier did not fetch updates for the first time when using
"once a day".
2025-05-10 11:44:04 -03:00
Alexandre Arnt
79dd707276 Updated tx 2025-05-10 10:27:57 -03:00
Alexandre Arnt
b1a6fb069c Updated tx 2025-04-26 10:38:16 -03:00
Alexandre Arnt
fb46f9acaa Updated tx 2025-03-15 10:38:54 -03:00
Alexandre Arnt
c86d07aac7 Trying one more time to handle aur params in zsh shell 2025-02-24 11:08:14 -03:00
Alexandre Arnt
c1f24851ea tx 2025-02-22 08:22:21 -03:00
Alexandre Arnt
771b7894ba - Bugfix in test 2025-02-20 19:12:24 -03:00
Alexandre Arnt
aed9f6e27c - BugFix: The act of moving the mouse over the package list was
triggering many "pacman -Si" executions (thanks to RAZUMNO)
2025-02-20 11:03:46 -03:00
Alexandre Arnt
f481213f69 Another cycle begins... 2025-02-19 11:17:21 -03:00
Alexandre Arnt
ab61b62e6d Update tx 2025-02-19 11:12:54 -03:00
Alexandre Arnt
dfb20233f8 Release date 2025-02-18 13:06:33 -03:00
Alexandre Arnt
9c7ed8cfaf - Remove ampersand from Options menu in notifier 2025-02-18 11:23:10 -03:00
Alexandre Arnt
3f25b41b31 Updated file 2025-02-17 19:50:35 -03:00
Alexandre Arnt
3283bec5a5 - Updated tx and release-translations.sh util. 2025-02-17 17:22:26 -03:00
Alexandre Arnt
ec61b6d688 - Clean unused code 2025-02-17 17:15:33 -03:00
Alexandre Arnt
b61d4601e2 Release prep 2025-02-15 19:34:50 -03:00
Alexandre Arnt
938c2403e0 Updated tx 2025-02-15 19:12:59 -03:00
Alexandre Arnt
8f13832c20 Release prep 2025-02-14 17:37:46 -03:00
Alexandre Arnt
2f2709faf1 Updated tx 2025-02-14 17:35:20 -03:00
Alexandre Arnt
c3fd32dc41 Updated tx 2025-02-13 18:46:29 -03:00
Alexandre Arnt
72287b3b88 - Do not translate 2 strings 2025-02-13 18:29:49 -03:00
Alexandre Arnt
4efd887252 - Adjust notifier too 2025-02-13 17:34:28 -03:00
Alexandre Arnt
ab08faaa5b - New str 2025-02-13 17:24:14 -03:00
Alexandre Arnt
6ca2083e03 - Added option to always use the terminal when executing pacman actions. 2025-02-13 17:01:51 -03:00
Alexandre Arnt
2fb3fdc98f - "Always Use the Terminal" code begins. 2025-02-12 19:53:21 -03:00
Alexandre Arnt
3853ca6ebd - Prefer BASH shell when executing commands. 2025-01-19 10:47:37 -03:00
Alexandre Arnt
da166f3f12 Updated tx 2025-01-05 11:04:51 -03:00
Alexandre Arnt
caec196c2e Merge pull request #577 from Integral-Tech/qstring-refactor
refactor: use arg() to enhance readability of string concatenation
2025-01-04 10:44:46 -03:00
Alexandre Arnt
190a7212eb Updated tx 2025-01-04 10:14:00 -03:00
Alexandre Arnt
3d14a55613 Udpated tx 2024-12-22 15:41:18 -03:00
Alexandre Arnt
944b792fb6 Udpated tx 2024-12-21 08:40:16 -03:00
Integral
35e7f07dda refactor: use arg() to enhance readability of string concatenation 2024-12-19 00:59:00 +08:00
Alexandre Arnt
011e7f0ab3 Merge pull request #576 from Integral-Tech/qstring-refactor
refactor: remove redundant QString() constructor calls
2024-12-18 13:15:29 -03:00
Integral
0619e7abef refactor: remove redundant QString() constructor calls 2024-12-18 21:09:37 +08:00
Alexandre Arnt
5afd387086 - Improvement: Let user choose which domain is pinged when checking for
internet access (if ping.archlinux.org is down).
2024-12-15 11:42:55 -03:00
Alexandre Arnt
9f8ca68053 Updated tx 2024-12-15 10:07:01 -03:00
Alexandre Arnt
6ef685235e - BugFix in aurtool params. 2024-11-09 11:33:49 -03:00
Alexandre Arnt
71451bc6b2 Updated tx 2024-11-03 08:55:44 -03:00
Alexandre Arnt
981c27d5db - Added "--editmenu" checkbox on Options dialog if you are using Yay
tool.
2024-10-05 12:22:29 -03:00
Alexandre Arnt
d98b35416f Updated tx 2024-09-28 17:28:06 -03:00
Alexandre Arnt
036ad9fa9e Updated tx 2024-09-15 10:19:20 -03:00
Alexandre Arnt
742c0c9450 Updated tx 2024-09-11 19:09:53 -03:00
Alexandre Arnt
5e2bc3d28d Updated tx 2024-09-11 18:30:12 -03:00
Alexandre Arnt
aa79b18143 - Warning busting. 2024-09-11 17:31:12 -03:00
Alexandre Arnt
8b42b92441 - Fix on play bell sound code. 2024-09-11 14:43:12 -03:00
Alexandre Arnt
ea20c392fe - Add "Play a bell sound" option to the General tab on optionsdialog. 2024-09-11 14:38:16 -03:00
Alexandre Arnt
4fe3873793 - Play a bell sound when the Terminal tab is asking for the user
password.
2024-09-09 20:13:41 -03:00
Alexandre Arnt
d984e110cb Updated tx 2024-09-08 08:54:08 -03:00
Alexandre Arnt
307d00c930 - Use "pacman -Qi" for "outdated" and "newer" pkgs. 2024-08-31 20:30:53 -03:00
Alexandre Arnt
ded9985f1d Updated tx 2024-08-31 09:56:02 -03:00
Alexandre Arnt
1737c189d6 Updated tx 2024-08-27 17:05:48 -03:00
Alexandre Arnt
fef6647228 - Updated tx. 2024-08-27 10:53:31 -03:00
Alexandre Arnt
22d8dbeb7b - BugFix: Help msg for newer packages was wrong because they're not
installed.
2024-08-27 10:30:17 -03:00
Alexandre Arnt
11f0244c14 Merge branch 'master' of https://github.com/aarnt/octopi 2024-08-26 14:42:07 -03:00
Alexandre Arnt
e92ae9e2ad Updated tx 2024-08-26 14:41:59 -03:00
Alexandre Arnt
da22dd0494 Merge pull request #566 from adolfintel/master
Use ping.archlinux.org for connectivity check
2024-08-21 11:33:33 -03:00
Federico Dossena
da78109d95 Use ping.archlinux.org for connectivity check 2024-08-21 10:34:22 +02:00
Alexandre Arnt
cb75753731 Updated tx 2024-08-15 17:39:57 -03:00
Alexandre Arnt
a2ef33a2c9 Merge pull request #565 from utuhiro78/master
Fix the Transifex page
2024-08-13 13:38:26 -03:00
utuhiro78
9e78ec4399 Fix the Transifex page 2024-08-13 18:04:19 +09:00
Alexandre Arnt
9fd06ba0a6 Updated tx 2024-08-03 10:05:33 -03:00
Alexandre Arnt
ef303c9cbe - Update parser. 2024-07-28 12:02:49 -03:00
Alexandre Arnt
5b95de1dc8 Updated pt_BR tx 2024-07-27 22:13:33 -03:00
Alexandre Arnt
7ea04ad750 - String fix 2024-07-21 10:06:15 -03:00
Alexandre Arnt
886b111b78 - BugFix: Code for EndeavorOS news was incomplete (thanks to
LegitGreenBoi).
2024-07-21 10:05:04 -03:00
Alexandre Arnt
bbd78805bf Updated tx 2024-07-13 15:15:33 -03:00
Alexandre Arnt
a09e782ead Updated tx 2024-06-30 10:15:12 -03:00
Alexandre Arnt
10b51b1416 - Improvement: Show a "Collecting transaction data..." msg before
presenting the transaction dialog, as it can be quite slow on some
systems (thanks to Valdir).
2024-06-23 19:49:12 -03:00
Alexandre Arnt
429bd605d4 Updated CHANGELOG 2024-06-20 19:30:17 -03:00
Alexandre Arnt
a12054032a Updated tx 2024-06-20 19:27:39 -03:00
Alexandre Arnt
dcc00671ee - BugFix: Increased width of Terminal tab labels on optionsdialog.
- BugFix: Removed a debug msg when octopi was not being executed with "-
d".
2024-06-17 19:39:26 -03:00
Alexandre Arnt
49555c98ba Preparation for 0.16.2 2024-06-17 19:03:46 -03:00
Alexandre Arnt
94f489a0b1 updated tx 2024-06-14 09:12:43 -03:00
Alexandre Arnt
91e00c84d2 - Mais uma vez... 2024-06-10 09:13:53 -03:00
Alexandre Arnt
1e3b31cc1c release prep 2024-06-09 18:07:17 -03:00
Alexandre Arnt
483064a956 - BugFix: Could not remove packages when internet connection was down
(thanks to Theluga).
2024-06-08 19:46:36 -03:00
Alexandre Arnt
8a3731b072 - Updated translations 2024-06-08 10:08:41 -03:00
Alexandre Arnt
ebf4ad9df9 - Updated translations 2024-06-06 21:47:18 -03:00
Alexandre Arnt
8aa2abe5ff - Unused?? 2024-06-06 19:53:51 -03:00
Alexandre Arnt
ddd97fd5ba fix optionsdialog ui 2024-06-06 19:46:55 -03:00
Alexandre Arnt
fe5df3e8a2 - version 0.16.1 prep 2024-06-06 17:36:04 -03:00
Alexandre Arnt
5bb8de6b6e - fix str 2024-06-06 16:29:12 -03:00
Alexandre Arnt
3408bebc0c - fix str 2024-06-06 16:27:09 -03:00
Alexandre Arnt
56641548d9 - str fix. 2024-06-06 16:12:55 -03:00
Alexandre Arnt
973fb2a473 - fix 2024-06-06 15:48:51 -03:00
Alexandre Arnt
fe4c704892 - fix 2024-06-06 15:46:09 -03:00
Alexandre Arnt
cb7b571dcc - fix 2024-06-06 15:45:17 -03:00
Alexandre Arnt
4afdd15784 - fix 2024-06-06 15:38:38 -03:00
Alexandre Arnt
53ea9fc062 - Version bump 2024-06-06 14:13:14 -03:00
Alexandre Arnt
e3d37d6f3d - BugFix: Do not install notifier's desktop file in /etc/xdg/autostart. 2024-06-06 13:55:34 -03:00
Alexandre Arnt
db9d26f858 - a small test. 2024-06-06 13:27:55 -03:00
Alexandre Arnt
e9c98087bc - BugFix: Info/Files tabs were always empty if they were selected at
octopi's start.
2024-06-06 10:18:15 -03:00
Alexandre Arnt
dff5d0ea9f - Arrow key navegation refreshes Info and Files tabs again. 2024-06-05 20:11:03 -03:00
Alexandre Arnt
6e7e3c6f4c - Added shortcut key "Ctrl+Shift+U" to upgrade outdated AUR packages. 2024-06-05 19:32:30 -03:00
Alexandre Arnt
bc44fa3d78 - Small fix in Files Tab code. 2024-06-05 13:30:43 -03:00
Alexandre Arnt
5cb760d1dc updated arabic tx 2024-05-27 20:04:17 -03:00
Alexandre Arnt
1ff9761e13 updated arabic tx 2024-05-27 20:04:00 -03:00
Alexandre Arnt
5d08cb59d6 Updated polish tx 2024-05-26 09:48:53 -03:00
Alexandre Arnt
33bdea2850 Merge branch 'master' of https://github.com/aarnt/octopi 2024-05-25 20:25:39 -03:00
Alexandre Arnt
9887f40a08 - BugFix: Updated some LANG environment variables to C.UTF-8. 2024-05-25 20:22:52 -03:00
Alexandre Arnt
8751898bd0 Merge pull request #557 from SGOrava/notifier-kf6
Fix building octopi-notifier with KF6
2024-05-25 19:35:55 -03:00
5af7cd8abc Fix building octopi-notifier with KF6
Use `KF6StatusNotifierItem` instead of `KF6Notifications`.

Signed-off-by: Juraj Oravec <jurajoravec@mailo.com>
2024-05-21 21:22:08 +02:00
Alexandre Arnt
1dbebc4ccc Bugfix in PKGBUILD 2024-05-19 12:34:04 -03:00
Alexandre Arnt
cf0122f936 -Updated translations. 2024-05-19 12:17:46 -03:00
Alexandre Arnt
05a1d28850 - 0.16.0 prep 2024-05-19 11:55:25 -03:00
Alexandre Arnt
99bc556cf3 - 0.16.0 prep 2024-05-19 11:04:23 -03:00
Alexandre Arnt
8c508c91c8 msg fix 2024-05-18 19:54:32 -03:00
Alexandre Arnt
e0708b73b6 - Default to Qt6 libs 2024-05-18 19:32:49 -03:00
Alexandre Arnt
aad8ac342e Preparing for 0.16.0 2024-05-18 19:11:09 -03:00
Alexandre Arnt
435f0281e5 - Bugfix in KSTATUS/pro 2024-05-18 17:50:35 -03:00
Alexandre Arnt
a081ac2bfd - Default to Qt6 lib build 2024-05-18 14:51:58 -03:00
Alexandre Arnt
d0fbc89b9e - Fix for QTERMWIDGET6 compat 2024-05-18 14:20:38 -03:00
Alexandre Arnt
eebfa41342 - Fix for QTERMWIDGET6 compat 2024-05-18 14:13:27 -03:00
Alexandre Arnt
a974769a4c - Updated qt-sudo strings. 2024-05-11 10:42:34 -03:00
Alexandre Arnt
69e85dddd2 Updated PKGBUILD file. 2024-03-11 09:17:30 -03:00
Alexandre Arnt
4f6101f1af - Removed buggy str. 2024-03-10 22:30:25 -03:00
Alexandre Arnt
644c5a3d78 - Fixed a typo. 2024-03-10 22:22:38 -03:00
Alexandre Arnt
cd32995a81 - Now using unified qt-sudo project. 2024-03-10 22:03:37 -03:00
Alexandre Arnt
64e72f06c9 - BugFix in notifier. 2024-03-04 19:44:39 -03:00
Alexandre Arnt
9037688da5 Fixed silent error when pacman's database is locked (thanks to SloppyPuppy). 2024-01-22 08:53:43 -03:00
Alexandre Arnt
8f9647e58f Merge pull request #546 from SloppyPuppy/master
fixed silent fail when pacman running
2024-01-22 08:50:08 -03:00
Момчило Ињац
039824122b fixed silent fail when pacman running 2024-01-21 11:50:07 +01:00
Alexandre Arnt
59c785f364 - BUGFIX: Yay AUR search was not working anymore. 2024-01-20 10:22:34 -03:00
Alexandre Arnt
f79da34b3e - BugFix: '--noeditmenu' is deprecated. Use '--editmenu=false' instead
(thanks to rbaruccojr).
2023-12-29 19:47:38 -03:00
Alexandre Arnt
b2e6dfc8a2 - Added files 2023-12-29 19:43:09 -03:00
Alexandre Arnt
3397776586 - Updated CHANGELOG. 2023-12-29 19:31:14 -03:00
Alexandre Arnt
d308c470eb - Another dev cycle begins... 2023-12-29 19:29:35 -03:00
Alexandre Arnt
a07a3a9b38 Merge pull request #540 from MatMoul/patch-1
Update PKGBUILD
2023-11-10 07:32:13 -03:00
MatMoul
71759c8f7e Update PKGBUILD
Update sed for knotifier.

The curent sed cmd don't match the regular expression!
2023-10-23 23:24:19 +02:00
Alexandre Arnt
b4301d72cc - Release preparation. 2023-09-10 22:35:35 -03:00
Alexandre Arnt
27f5df6aef - Updated translations. 2023-09-10 20:54:35 -03:00
Alexandre Arnt
0cddcd876d - Always recreate helper log file. 2023-09-09 20:25:17 -03:00
Alexandre Arnt
8a9465738d Removed unused pkg 2023-09-09 19:35:03 -03:00
Alexandre Arnt
1416d16f49 - Using "pacman -Fl" to view contents of non installed packages (thanks
to Zesko).
2023-09-09 19:32:36 -03:00
Alexandre Arnt
d99839e7e9 - Small bugfix. 2023-09-09 16:51:25 -03:00
Alexandre Arnt
2521696214 - Bunch of bugfixes. 2023-09-09 15:53:20 -03:00
Alexandre Arnt
24a1423de0 - Parser fixes. 2023-09-08 23:30:07 -03:00
Alexandre Arnt
6d97331ff2 - Garuda Linux string parsing. 2023-09-08 23:19:01 -03:00
Alexandre Arnt
f60d7d971e - Small bugFixes. 2023-08-27 14:07:48 -03:00
Alexandre Arnt
d8a1722d2a - Fix in octopi helper code. 2023-08-26 11:09:04 -03:00
Alexandre Arnt
9085b6ca56 - BugFix: Change install reason did not work with pacman backend. 2023-08-26 11:00:59 -03:00
Alexandre Arnt
bebc5d1276 - Removed unused code. 2023-08-26 09:44:11 -03:00
Alexandre Arnt
bbccd59fed - Fix in helper code. 2023-08-26 09:36:16 -03:00
Alexandre Arnt
1335406977 - Enable again the helper logfile. 2023-08-25 17:59:07 -03:00
Alexandre Arnt
e7f783cc52 - Remove unused code. 2023-08-24 18:07:56 -03:00
Alexandre Arnt
a4d718b8b7 Added support for Qt5/Qt6 libs 2023-08-15 20:24:34 -03:00
Alexandre Arnt
1fa610f194 - Added support for both Qt5 and Qt6 libs. 2023-08-13 16:25:59 -03:00
Alexandre Arnt
f59315cd60 Support both Qt5 and Qt6 libs 2023-08-13 11:05:23 -03:00
Alexandre Arnt
712a43f39e - Made the code a bit more Qt6 friendly. 2023-08-01 17:37:09 -03:00
Alexandre Arnt
7e3c26adbf - Made the code a bit more Qt6 friendly. 2023-08-01 16:32:31 -03:00
Alexandre Arnt
030efb79b5 - Made the code a little bit more Qt6 friendly. 2023-08-01 16:10:42 -03:00
Alexandre Arnt
43b7e86f84 - Fixed sizes. 2023-07-24 22:39:15 -03:00
Alexandre Arnt
f403fd7f9a - Added a Terminal tab to options dialog to config its colors and fonts. 2023-07-24 22:35:40 -03:00
Alexandre Arnt
dfb0062aa0 - BugFix in octopi/notifier Updates tab code. 2023-07-24 09:28:02 -03:00
Alexandre Arnt
455ae4853f - BugFix: When using the pacman backend, call "pacman -Qm" to fetch ALL
foreign packages.
2023-07-23 09:36:28 -03:00
Alexandre Arnt
8d7e4eac39 - Stop calling Octopi's option dialog when Octopi was running. 2023-07-23 09:21:14 -03:00
Alexandre Arnt
71dcb5fdcb Updated files 2023-07-04 11:05:52 -03:00
Alexandre Arnt
7fdabbe9ef - BugFix: AUR passwords that contain a "+" char failed to login at
aur.archlinux.org.
2023-07-03 16:46:41 -03:00
Alexandre Arnt
630f4efd17 Fix in helper code. 2023-06-20 17:11:20 -03:00
Alexandre Arnt
4b12c8b06f - Better error logic in helper code. 2023-06-17 10:07:58 -03:00
Alexandre Arnt
c5f1e9694d - PressAnyKeyToContinue equals PAKtC now. 2023-06-17 10:00:01 -03:00
Alexandre Arnt
cbd43ab731 - Octopi-sudo code was synced to match project "lxqt-sudo" version
1.3.0.
2023-06-08 11:26:39 -03:00
Alexandre Arnt
1166691c37 - BugFix: Polished navigation on Info tab dependencies 2023-06-08 11:14:37 -03:00
Alexandre Arnt
e98fec0fb9 - Trying to fix Helper's aborted transactions caused by broken string
errors.
2023-06-08 09:30:39 -03:00
Alexandre Arnt
d0a30a9eca - BugFix: First yay-bin download now works again. 2023-05-22 14:26:27 -03:00
Alexandre Arnt
a92868cbb3 Merge pull request #522 from ShalokShalom/patch-1
fix typo
2022-12-20 07:22:43 -03:00
ShalokShalom
db36d56be9 fix typo 2022-12-20 03:58:28 +01:00
Alexandre Arnt
2db10e3b4b - Octopi-sudo code was synced to match project "lxqt-sudo" version
1.2.0.
2022-11-05 11:11:39 -03:00
Alexandre Arnt
3e3acfde39 - BugFix: Better handle dependencies while staging packages for
deletion.
2022-11-02 21:53:09 -03:00
Alexandre Arnt
a994beb935 - BugFix: invalidate Info/File tabs when user is navigating packages
using the keyboard.
2022-10-29 09:41:04 -03:00
Alexandre Arnt
144a8ca86e - Another dev cycle (0.15) begins... 2022-10-23 09:52:43 -03:00
Alexandre Arnt
462bfec623 - Updated CMakeLists.txt file. 2022-10-05 22:37:48 -03:00
Alexandre Arnt
0a47127c71 - Release preparation... 2022-10-05 22:19:02 -03:00
Alexandre Arnt
ba9a934c7c - BugFix: Package search did not work correctly when query string
contained a "+" sign.
2022-10-04 22:35:06 -03:00
Alexandre Arnt
d726e53976 - BugFix: AUR search did not work correctly when query string contained
a "+" sign.
2022-10-03 22:15:26 -03:00
Alexandre Arnt
06c42e047e Updated translations 2022-09-24 16:21:07 -03:00
Alexandre Arnt
5abd25ff76 Update README.md
Updated README file. RIP Chakra :-(
2022-09-15 11:18:54 -03:00
Alexandre Arnt
15f33ee87c Update CHANGELOG
Updated CHANGELOG
2022-09-15 11:07:40 -03:00
Alexandre Arnt
8b4db5bbd3 - Removed unneeded code. 2022-07-25 16:30:58 -03:00
Alexandre Arnt
a4687d1a95 - Added --overwrite="*" checkbox in AUR tab (Tools/Options) when using
yay.
2022-07-25 16:24:24 -03:00
Alexandre Arnt
1a44290006 Updated translations 2022-07-25 09:44:27 -03:00
Alexandre Arnt
d16f189c72 BugFix: Info/Files tab refresh was duplicated (another try). 2022-06-26 11:21:43 -03:00
Alexandre Arnt
3ce25e63c5 - BugFix: Info/Files tab refresh was duplicated;
- BugFix: Disable (another try) Info/Files tab refresh while typing in
Filter/Search line edit;
- Updated translations.
2022-06-25 11:11:55 -03:00
Alexandre Arnt
029ecfbedf - Synced octopi-sudo code with lxqt-sudo version 1.1.0. 2022-05-01 11:02:59 -03:00
Alexandre Arnt
1b8d9aca43 Again and again... 2022-04-16 09:05:12 -03:00
Alexandre Arnt
00b40f1a87 Play it again, Sam 2022-04-16 09:01:09 -03:00
Alexandre Arnt
fd0307f033 Release preparation 2022-03-30 13:10:59 -03:00
Alexandre Arnt
0e9e3be096 Release preparation 2022-03-30 13:09:32 -03:00
Alexandre Arnt
18ed4434b0 Release preparation 2022-03-30 13:04:29 -03:00
Alexandre Arnt
3b03f26086 - Fix compile warning 2022-03-30 12:50:39 -03:00
Alexandre Arnt
f73ff0c5ea Updated repoeditor CMakeLists 2022-03-30 12:32:57 -03:00
Alexandre Arnt
b2507b5b74 - Fixed a compilation warning;
- Added a desktop file to Repository Editor;
- Updated desktop files
- Bumped version to 0.13.0
2022-03-30 11:26:02 -03:00
Alexandre Arnt
31d1fd5896 Updated translations 2022-03-28 11:55:52 -03:00
Alexandre Arnt
96c29a1304 Merge pull request #512 from nicolasfella/singlewindow
Mark as single window app
2022-03-22 07:20:40 -03:00
Nicolas Fella
849bd94007 Mark as single window app
There can only be one main window at a time, mark it as such in the desktop file

That way desktop environments know to not offer to open a second window
2022-03-22 00:28:35 +01:00
Alexandre Arnt
8ae9a89e88 - Added option to update the selected outdated AUR pkg directly from the
main list.
2022-03-20 22:45:06 -03:00
Alexandre Arnt
4fd04ad81c - Remove unused code. 2022-03-04 12:03:04 -03:00
Alexandre Arnt
8e9fe4a3c7 Updated CHANGELOG 2022-03-04 11:59:14 -03:00
Alexandre Arnt
27d35b4ff3 - Small fix in notifier code. 2022-03-03 22:36:55 -03:00
Alexandre Arnt
242d1eae2f - Bump Octopi version in PKGBUILD. 2022-03-03 21:49:10 -03:00
Alexandre Arnt
7ff4a64039 - Added a "-checkupdates" parameter to Notifier, so users can update the
status of an already running Octopi Notifier.
2022-03-03 19:15:11 -03:00
Alexandre Arnt
62127f516f - Remove unused code. 2022-03-03 15:02:36 -03:00
Alexandre Arnt
2b7eead911 Updated translations 2022-03-03 14:52:33 -03:00
Alexandre Arnt
45edde8688 - Made Octopi compatible with aurweb 6.x version (vote/unvote/list AUR). 2022-03-02 12:42:27 -03:00
Alexandre Arnt
e238e4cdd0 - AurVote testing code. 2022-03-01 17:48:59 -03:00
Alexandre Arnt
aa86dff054 - Fixed PKGBUILD and PKGBUILD diff options. 2022-03-01 17:42:56 -03:00
Alexandre Arnt
e5c7c85c81 Merge pull request #507 from glls/master
Make curl follow redirect (301) for news feed
2022-02-06 10:26:09 -03:00
George Litos
040730e9a4 Make curl follow redirect (301) for news feed 2022-02-04 14:45:13 +02:00
Alexandre Arnt
76a4ac7874 Updated translations 2022-01-31 13:59:40 -03:00
Alexandre Arnt
44a14d8eb1 Merge pull request #505 from vnepogodin/master
🔥 Add cachyos support
2022-01-18 10:21:54 -03:00
Vladislav Nepogodin
d6db207676 🔥 add cachyos support 2022-01-17 20:40:56 +04:00
Alexandre Arnt
6dd83e5e53 - Added xdg-open option on editFile(). 2021-12-22 18:37:01 -03:00
Alexandre Arnt
f0ee8c6e03 Updated translations 2021-12-18 09:08:32 -03:00
Alexandre Arnt
91eff99690 - BugFix: "View Outdated" option was not being disabled while Octopi was
executing a transaction.
2021-12-18 09:03:48 -03:00
Alexandre Arnt
7cd3f9b96a - BugFix: editFile() caused a crash while in Mate desktop. Both "Open
PKGBUILD" and "Show PKGBUILD diff" options were affected.
2021-12-16 19:23:16 -03:00
Alexandre Arnt
ce98289abd - Another dev cycle begins;
- BugFix: Pressing ENTER over an installed AUR pkg no longer sends it to
the install action treeview;
- Added "Outdated" filter/option on menu "View";
2021-12-12 10:34:17 -03:00
Alexandre Arnt
d3a6e85c68 - Removed stylesheet from treeviews. It makes dark themes look better. 2021-11-28 10:16:27 -03:00
Alexandre Arnt
74b4a79974 Merge pull request #499 from buckmelanoma/add_options_icon
Add getIconOptions icon for Options menu
2021-11-28 10:08:29 -03:00
buckmelanoma
79f5d61972 Typo fix 2021-11-21 16:42:44 -08:00
Buck Melanoma
b974aff871 Add getIconOptions icon for Options menu 2021-11-21 16:38:55 -08:00
Alexandre Arnt
31980010af Updated CHANGELOG 2021-11-06 18:31:12 -03:00
Alexandre Arnt
6fd963066f Preparation for 0.12.0 release 2021-11-06 17:46:23 -03:00
Alexandre Arnt
f5b16db539 Octopi-sudo code was synced to match project lxqt-sudo version 1.0.0. 2021-11-06 14:57:53 -03:00
Alexandre Arnt
cc27dcadec Updated README file 2021-10-24 11:34:31 -03:00
Alexandre Arnt
5170d1658c Merge branch 'master' of https://github.com/aarnt/octopi 2021-10-23 19:59:34 -03:00
Alexandre Arnt
d2ea008331 - Added support for Obarun Linux. 2021-10-23 19:59:18 -03:00
Alexandre Arnt
06cbf74d32 Merge pull request #496 from dr460nf1r3/master
Use Garuda forum announcement feed for distro news
2021-10-19 06:56:03 -03:00
dr460nf1r3
d7330ed2f0 Use Garuda forum announcement feed for distro news 2021-10-19 08:06:14 +02:00
Alexandre Arnt
29525448bc BugFix: Do not call pacman/alpm methods when Octopi is running a
transaction.
2021-10-13 10:20:37 -03:00
Alexandre Arnt
52ba603816 Updated README file 2021-10-12 16:17:29 -03:00
Alexandre Arnt
173d7f08ef Updated README file 2021-10-12 16:16:41 -03:00
Alexandre Arnt
733b4abdb5 Updated README file 2021-10-12 16:03:22 -03:00
Alexandre Arnt
7572eb55f2 - Small change on openFile method. 2021-10-12 11:40:14 -03:00
Alexandre Arnt
97d9f23d5a - Disable devel param when used AUR tool is paru. 2021-10-12 10:59:16 -03:00
Alexandre Arnt
c4feb158a8 - AUR check changes. 2021-10-09 21:59:03 -03:00
Alexandre Arnt
539b708460 - BugFix: if distro news url settings is empty, let's populate with
correct news site.
2021-10-07 20:20:44 -03:00
Alexandre Arnt
6e0ba4db3b Merge branch 'master' of https://github.com/aarnt/octopi 2021-10-02 11:16:24 -03:00
Alexandre Arnt
a8628f05d8 - Another try on Garuda Linux guessing code. 2021-10-02 11:16:07 -03:00
Alexandre Arnt
05eda76963 Merge pull request #492 from IceCryptonym/paru-fix
Fix Paru "no packages match search"
2021-09-27 21:34:55 -03:00
IceCryptonym
0df51acc45 Fix Paru "no packages match search" 2021-09-27 09:29:11 +10:00
Alexandre Arnt
0d8fbdfa18 README fix 2021-09-19 09:25:46 -03:00
Alexandre Arnt
09e654469f - Added support for Archcraft OS. 2021-09-19 09:23:54 -03:00
Alexandre Arnt
b24e82c0ca README typo 2021-09-18 10:32:23 -03:00
Alexandre Arnt
fbc98fcf92 - README update. 2021-09-18 10:31:29 -03:00
Alexandre Arnt
7bd9c32887 - Added support for Garuda Linux distro. 2021-09-18 10:00:52 -03:00
Alexandre Arnt
d8ce53ef5c - BugFix: Initial database searches are executed after main interface is
shown. This improves UI feedback on older cpus.
2021-09-04 10:48:04 -03:00
Alexandre Arnt
0fe112410c - Actions tab shows a counter feedback for inserts (with a plus signal)
and removals (with a minus signal) and does not steal focus anymore.
2021-09-04 09:50:07 -03:00
Alexandre Arnt
7bb69677ab - BugFix: removed buggy string. 2021-08-21 08:28:01 -03:00
Alexandre Arnt
33b937e082 Updated translations 2021-07-03 11:47:52 -03:00
Alexandre Arnt
25de491e20 - Removed string bugs in parser with pacman 6.0. 2021-07-03 09:37:51 -03:00
Alexandre Arnt
22a0fcbb90 - BugFix in pacman version test.
- BugFix in parser while removing pkgs.
2021-06-19 10:26:04 -03:00
Alexandre Arnt
f063177f2c - More parser fixes for pacman 6.0. 2021-06-06 11:07:57 -03:00
Alexandre Arnt
794c27c4c9 - BugFix: checkupdates (from pacman-contrib 1.4.0) was not outputing a
<BR> to separate new lines.
2021-06-06 10:31:27 -03:00
Alexandre Arnt
f5b9270bbd - Added parser support for pacman 6.0. 2021-06-03 15:23:43 -03:00
Alexandre Arnt
7c35dfd845 Updated translations 2021-05-29 08:40:31 -03:00
Alexandre Arnt
c87555e0be - BugFix: IgnorePkg pkgs are shown as outdated when using ALPM backend. 2021-05-23 11:19:17 -03:00
Alexandre Arnt
f483aa60f7 - Synced with LXQt-sudo code. 2021-04-15 11:09:17 -03:00
Alexandre Arnt
fe6dee7723 - BugFix: If options dialog was called while both notifier and octopi
were running, Updates tab was not shown.
2021-04-05 16:55:02 -03:00
Alexandre Arnt
bfc98aebdb Updated translations 2021-03-30 15:14:18 -03:00
Alexandre Arnt
baa7259340 Updated translations 2021-03-26 14:58:52 -03:00
Alexandre Arnt
1c59c599c7 - Commented uneeded watcher disconnect. 2021-03-17 16:03:17 -03:00
Alexandre Arnt
8f1ca44eb2 Updated translations 2021-03-11 10:49:08 -03:00
Alexandre Arnt
1dffe7e231 Merge branch 'master' of https://github.com/aarnt/octopi 2021-03-09 12:54:51 -03:00
Alexandre Arnt
1998da1cf0 Updated translations. 2021-03-09 12:54:32 -03:00
Alexandre Arnt
085e9be8ae Merge pull request #477 from luis-pereira/readability
Readability
2021-03-05 17:29:21 -03:00
Alexandre Arnt
c0ffbf1422 Updated translations 2021-02-27 17:57:32 -03:00
Luís Pereira
900d49c227 Simplify logic expressions (continued)
Done by hand. Clazy didn't fixit.
2021-02-17 16:24:02 +00:00
Luís Pereira
8bb9ebc512 Simplify logic expressions
Much cleaner code. Done by clang-tidy.
2021-02-16 17:21:37 +00:00
Luís Pereira
3f47c2127c Use the empty method to test for emptiness
Much more readable than size == 0.
2021-02-15 19:56:03 +00:00
Luís Pereira
f0a7fef072 Don't check against nullptr before delete
It's fine to delete a null pointer.
2021-02-15 19:41:49 +00:00
Alexandre Arnt
16fd585d2e Merge pull request #474 from luis-pereira/use-qstring-multi-arg
Use QString multi arg
2021-02-12 10:01:36 -03:00
Luís Pereira
5469925a40 Use QString multi arg
Less memory allocations.
2021-02-10 18:29:58 +00:00
Alexandre Arnt
c9f21b2d5c PKGBUILD updated; Removed install file. 2021-02-10 13:46:25 -03:00
Alexandre Arnt
d6a6ecc504 - BugFix: Alpm related compilation error. 2021-02-10 10:57:47 -03:00
Alexandre Arnt
c900d85241 Updated translations 2021-02-08 15:26:42 -03:00
Alexandre Arnt
80508a3df4 updated changelog 2021-02-06 17:07:16 -03:00
Alexandre Arnt
f98f74447b Updated README 2021-02-06 16:27:29 -03:00
Alexandre Arnt
2909208e97 - Completed aur rpc search code (testing only). 2021-02-06 16:20:48 -03:00
Alexandre Arnt
30b938cc17 - Test code for retrieving AUR pkgs using https/rpc api (not working
100% and slower than aur helpers)
2021-02-05 19:12:06 -03:00
Alexandre Arnt
a63d970ae3 - Updated octopi-sudo readme. 2021-02-05 16:03:18 -03:00
Alexandre Arnt
622c041e3b - Method name/variables refactorings 2021-02-05 15:52:47 -03:00
Alexandre Arnt
a96ad4190b - Refactored KaOS/KCP pkg search code. 2021-02-05 14:53:09 -03:00
Alexandre Arnt
c503c6cce0 - Another step in completing Paru support. 2021-02-05 10:42:43 -03:00
Alexandre Arnt
1234d31bc6 - BugFix: If user went from AUR to normal search with a not found pkg
the statusbar counters would become invisible.
2021-01-31 12:28:19 -03:00
Alexandre Arnt
46ac37fc4a - Added support for opendoas tool (default). 2021-01-31 11:44:47 -03:00
Alexandre Arnt
c4739bd5c9 - Small refactor due to clazy feedback. 2021-01-30 23:56:09 -03:00
Alexandre Arnt
ac0ee5df2f - Added initial support for Paru AUR tool;
- Some refactorings due to clazy feedback.
2021-01-30 23:51:29 -03:00
Alexandre Arnt
3f5594e143 - Another dev cycle begins... 2021-01-30 21:39:49 -03:00
Alexandre Arnt
224665bf29 - BugFix: Get rid of unused variable. 2021-01-29 09:46:53 -03:00
Alexandre Arnt
ac2990ab15 Merge pull request #472 from luis-pereira/perf-for-range-loop
Perf for range loop
2021-01-29 09:28:45 -03:00
Luís Pereira
84ebf2d239 Avoid container detachment in range for loops - Part 2
* Make container const
* Use qAsConst()

Done manually.
2021-01-28 17:04:19 +00:00
Luís Pereira
d4289dc66b Avoid container detachment in range for loops - Part 1
Use qAsConst() to prevent implicitly-shared Qt containers from detaching.
Done by clazy fixit.
2021-01-28 17:04:18 +00:00
Luís Pereira
d0bed2979a Use const references in ranged for loop variables
They are copied but only used as const references.
Performance improvement.
2021-01-28 17:04:08 +00:00
Alexandre Arnt
d128b0e8ac Merge pull request #469 from luis-pereira/use-const-references
Use const reference where possible
2021-01-27 14:43:42 -03:00
Luís Pereira
698423dba9 Use const reference where possible
It increases performance.
2021-01-25 19:54:10 +00:00
Alexandre Arnt
2ee7414b0e Merge pull request #468 from luis-pereira/use-nullptr
Use C++11 nullptr
2021-01-22 14:51:29 -03:00
Luís Pereira
b49b52a26a Use C++11 nullptr 2021-01-22 12:49:03 +00:00
Alexandre Arnt
f147678491 Updated CHANGELOG 2021-01-11 12:59:30 -03:00
Alexandre Arnt
5b8dfb0388 - Removed unused parameters from Octopi's main project file. 2021-01-11 12:25:47 -03:00
Alexandre Arnt
50e1c6bb85 - Release preparation... 2021-01-11 11:24:50 -03:00
Alexandre Arnt
4805a95ff8 - Updated translation. 2021-01-08 15:17:46 -03:00
Alexandre Arnt
c5688495c0 - BugFix: Clicking on printed outdated packages in Output tab did not
send to corresponding package in the main list after a 'Check updates'.
2021-01-06 21:57:57 -03:00
Alexandre Arnt
400c4750fd - Removed unneeded code. 2021-01-06 21:30:41 -03:00
Alexandre Arnt
ab8af8bc6e - Refactorings to decouple some logic. 2021-01-06 19:00:49 -03:00
Alexandre Arnt
bb06f38da9 Merge branch 'master' of https://github.com/aarnt/octopi 2021-01-02 10:21:42 -03:00
Alexandre Arnt
7f15a34bc9 - Updated translations. 2021-01-02 10:21:34 -03:00
Alexandre Arnt
8e9e0d05e9 Update README.md 2020-12-30 19:05:25 -03:00
Alexandre Arnt
a85d8af58f Update README.md 2020-12-30 19:04:50 -03:00
Alexandre Arnt
241f9e7241 - Supress buggy string in parser. 2020-12-22 15:41:30 -03:00
Alexandre Arnt
b5fda06f3e - BugFix: Prevent icon changes in notifier when there were transaction
errors.
2020-12-22 14:50:26 -03:00
Alexandre Arnt
ded5f7313a Updated translations. 2020-12-22 10:21:32 -03:00
Alexandre Arnt
cda6193af7 Updated translations 2020-12-21 11:55:24 -03:00
Alexandre Arnt
d23117a714 - Remove www from Arch url;
- Updated translations.
2020-12-19 17:44:51 -03:00
Alexandre Arnt
226d0425c4 - Small refactor. 2020-12-17 16:51:31 -03:00
Alexandre Arnt
70d6220f4e - BugFix: WM detection now uses "ps -aux";
- Updated translations.
2020-12-17 10:06:19 -03:00
Alexandre Arnt
a6349334a1 Updated translations 2020-12-11 09:47:07 -03:00
Alexandre Arnt
9f228d393a - Updated translations. 2020-12-10 16:20:48 -03:00
Alexandre Arnt
8599400779 - Updated translations. 2020-12-10 11:08:16 -03:00
Alexandre Arnt
eef29fb556 - String fix. 2020-12-08 11:03:36 -03:00
Alexandre Arnt
773caf0e0c - Prevent users from running Octopi, Notifier and Cache Cleaner outside
"/usr/bin" dir.
2020-12-07 13:34:45 -03:00
Alexandre Arnt
70f1445df5 Merge branch 'master' of https://github.com/aarnt/octopi 2020-12-01 18:55:54 -03:00
Alexandre Arnt
d35f3759a9 Removed service target 2020-12-01 18:55:07 -03:00
Alexandre Arnt
590c4143e1 Update CHANGELOG
Fixed typo
2020-11-30 18:41:07 -03:00
Alexandre Arnt
42e8e4ed2b - Bugfix in flag initialization. 2020-11-30 15:56:25 -03:00
Alexandre Arnt
6563139418 - BugFix: Disable Info/Files tab refresh while typing in filter/search
line edit.
2020-11-30 15:15:14 -03:00
Alexandre Arnt
6209e80e4c - Whenever user selects "Check updates" in notifier and octopi is
running, octopi processes the request.
2020-11-29 11:03:15 -03:00
Alexandre Arnt
5e1e70666e Updated screenshot 2020-11-29 10:23:39 -03:00
Alexandre Arnt
4c93c474ff - BugFix: disable "change install reason option" while in transaction;
- Disable stop button after post-download phase in pacman.
2020-11-29 10:10:23 -03:00
Alexandre Arnt
e5ef5085e5 - BugFix: KaOS fixes to kcp search and install.
- BugFix: Statusbar showed a number of packages when the list was empty
(the previous value).
2020-11-27 17:44:28 -03:00
Alexandre Arnt
3b94072502 - Reverted changes in open PKGBUILD methods;
- Keep open PKGBUILD options enabled while building packages.
2020-11-26 11:22:56 -03:00
Alexandre Arnt
535c70e695 - Trying to use another download method in open PKBUILD/diff. 2020-11-25 18:48:29 -03:00
Alexandre Arnt
0d1a835f66 - Added support to gedit in editFile method. 2020-11-25 16:38:52 -03:00
Alexandre Arnt
36f5c818d1 - Refactorings in propertiestabwidget calls and openfile code. 2020-11-25 12:06:08 -03:00
Alexandre Arnt
e8794007d6 - Updated CHANGELOG. 2020-11-25 11:24:44 -03:00
Alexandre Arnt
033b327ee6 - Refactorings for AUR based variable names. 2020-11-25 10:49:14 -03:00
Alexandre Arnt
9258b3a252 - Added support to build multiple foreign packages at the same time
(they are first copied to the Actions' tree view just like official
packages).
2020-11-24 20:13:04 -03:00
Alexandre Arnt
beb8d45dac - Some small refactorings. 2020-11-23 19:08:32 -03:00
Alexandre Arnt
34d38280ff - Another try to fix terminal issues while in AUR. 2020-11-23 12:32:24 -03:00
Alexandre Arnt
e553367f22 - Fixed some crashes from previous changes. 2020-11-20 18:59:30 -03:00
Alexandre Arnt
a7cf805cda - BugFix: If you tried to execute octopi after upgrading your system
with notifier you got a notifier crash and an octopi freeze (thanks to
linuxer for pointing that out).
2020-11-16 19:57:51 -03:00
Alexandre Arnt
fd1b3516f4 - Added "Open news in a browser" option on right clicking the News tab. 2020-11-15 10:58:51 -03:00
Alexandre Arnt
6e05037eb9 - Added a red border in the AUR warning rectangle;
- Removed unused code in optionsdialog.cpp.
2020-11-11 18:32:30 -03:00
Alexandre Arnt
5845f49b79 Updated screenshot 2020-11-11 17:59:54 -03:00
Alexandre Arnt
d7c2d23dfa - Removed unused code. 2020-11-11 12:42:34 -03:00
Alexandre Arnt
6bebce8693 - BugFix: Removed tab focus from stop transaction button. 2020-11-11 12:29:42 -03:00
Alexandre Arnt
483bdf85e1 - BugFix: Removed tab focus from "outdated" buttons at statusbar. 2020-11-11 12:25:44 -03:00
Alexandre Arnt
4ae0c6f436 - BugFix: "total download size" showed the value 0 in Notifier if the
database was not synched.
2020-11-11 12:15:44 -03:00
Alexandre Arnt
3da5a4eac5 - BugFix: Tab navigation improvements. 2020-11-10 19:40:26 -03:00
Alexandre Arnt
83087072c2 - Updated getPackageSize code. 2020-11-10 15:09:03 -03:00
Alexandre Arnt
268dea6272 - Removed unused test. 2020-11-10 12:29:27 -03:00
Alexandre Arnt
b966faa0dd - Added "Depends On" and "Make Deps" fields at Info tab while in AUR
mode.
2020-11-10 12:15:31 -03:00
Alexandre Arnt
2f96f12386 - Added support for '^' and '$' chars in AUR search. 2020-11-10 11:06:29 -03:00
Alexandre Arnt
3e50690e0c - BugFix in Open PKGBUILD/Show PKGBUILD diff with "Package base" code. 2020-11-08 22:22:42 -03:00
Alexandre Arnt
c53774609b - Added "Show PKGBUILD diff" option to show the differences between latest
and previous PKGBUILD files of the selected AUR package in a text editor.
2020-11-08 10:38:48 -03:00
Alexandre Arnt
e3f626da8f - Removed unused code. 2020-11-07 19:27:00 -03:00
Alexandre Arnt
ce1821f8dd - Added "Open PKGBUILD" option to open the AUR PKGBUILD file in a text
editor.
2020-11-07 19:12:53 -03:00
Alexandre Arnt
ecc737d336 - Updated searchlineedit style for not found itens while in KaOS. 2020-11-06 12:10:48 -03:00
Alexandre Arnt
e553a4f045 Merge branch 'master' of https://github.com/aarnt/octopi 2020-11-05 19:59:47 -03:00
Alexandre Arnt
cfb04970a8 - Updated CHANGELOG file. 2020-11-05 19:59:27 -03:00
Alexandre Arnt
bd7d92d18b Merge pull request #457 from Tereius/master
Introduce CMake build system
2020-11-05 19:56:21 -03:00
Alexandre Arnt
cc9811b6de - Updated CHANGELOG file. 2020-11-05 17:12:26 -03:00
Alexandre Arnt
746bb9d7da - Synced octopi-sudo code from lxqt-sudo 0.16.0. 2020-11-05 17:06:15 -03:00
Alexandre Arnt
a3f84b1573 - BugFix in help content. 2020-11-04 19:32:21 -03:00
Alexandre Arnt
7a63e3fc2f - Changed aurvote code to fix an issue. 2020-11-04 18:22:18 -03:00
Alexandre Arnt
885ec83b23 - Debug aurvote code. 2020-11-04 17:10:47 -03:00
Alexandre Arnt
91fdfc8c47 - Another aurvote debug code. 2020-11-04 17:07:18 -03:00
Alexandre Arnt
aa71f64d95 - More debug information in aurvote code. 2020-11-04 16:20:13 -03:00
Alexandre Arnt
188f71b46b - Added "Maintainer", "Last Modified" and "Out-of-date" fields
at Info tab while in AUR mode.
2020-11-03 18:29:23 -03:00
Alexandre Arnt
9825be81b4 - Added "Build directory" option in AUR tab on options dialog, so users
can change where makepkg builds the source code.
2020-10-26 17:53:40 -03:00
Alexandre Arnt
20f4eb2810 - BugFix: Do not permit changing install reason while in AUR mode. 2020-10-25 19:08:51 -03:00
Alexandre Arnt
79a7f4f698 - BugFix: Restored support for command line parameters like "-
sysupgrade-noconfirm" and "-style";
- BugFix: Updated "-help" output text..
2020-10-25 11:10:15 -03:00
Alexandre Arnt
039f98130d - BugFix in pkg version/outdated version. 2020-10-23 20:20:11 -03:00
Alexandre Arnt
c780060214 - Optional package dependencies are now installed with "--asdeps"
parameter.
2020-10-23 19:15:01 -03:00
Alexandre Arnt
a34ba69c24 - Added option to "Change Install Reason" of selected packages
(Explicitly <-> As Dependency).
2020-10-22 18:11:09 -03:00
Alexandre Arnt
af881e7912 - BugFix: Running Notifier within a DE session would lead to a
"Suspicious execution method" error.
2020-10-22 15:10:52 -03:00
Alexandre Arnt
93f3c74a59 - BugFix: Pressing ESC in repoeditor could ask if you wanted to save
your changes even if there were no changes made.
2020-10-20 19:32:36 -03:00
Björn Stresing
db058e35f5 Add Qt5 package min. version check 2020-10-20 19:38:28 +02:00
Björn Stresing
d1347b1820 Update README.md, change install location of octphelper and octopi-sudo 2020-10-20 16:35:34 +02:00
Björn Stresing
33ceb0178f Add missing files to install target, add missing translations 2020-10-17 19:53:13 +02:00
Björn Stresing
baeb542b38 Merge remote-tracking branch 'upstream/master' into master 2020-10-17 18:11:27 +02:00
Alexandre Arnt
fd787a74fc - Faster instant search code. 2020-10-12 15:32:56 -03:00
Alexandre Arnt
e60c516177 - Added a faster refresh package list code after checking for updates;
- Replaced "foreach" for "for".
2020-10-12 14:58:35 -03:00
Alexandre Arnt
b32e94e0ce - BugFix: removed unused code. 2020-10-10 15:29:25 -03:00
Alexandre Arnt
67f6692a48 - Added option to display "Licenses", "Installed Size", "Build Date",
"Install Date" and "Install Reason" columns in the package list;
- Added "Install Date" at Info tab;
- Added "Licenses" at Info tab while in AUR mode.
2020-10-10 15:05:58 -03:00
Alexandre Arnt
0ad770c83e - Striping some unused code. 2020-10-05 12:18:23 -03:00
Alexandre Arnt
05a891b2a6 BugFix: updated wrong path reference. 2020-10-05 10:37:15 -03:00
Alexandre Arnt
a1ed637f31 - Removed string replaces from generated sysinfo file. 2020-10-04 19:24:59 -03:00
Alexandre Arnt
8ae7a0fd8f BugFix: QtSingleApplication class does not like messing with TMPDIR
variable too...
2020-10-04 19:10:42 -03:00
Alexandre Arnt
42064d75df - A new release cycle begins: 0.11 (dev);
- Updated PKGBUILD file following MatMoul's suggestion;
- Removed unused speedup service;
- BugFix: unset TMPDIR environment variable on every Octo tool startup
(to avoid "octopi-helper[aborted]: Couldn't attach to memory" errors).
2020-10-04 18:22:05 -03:00
Björn Stresing
064cb3ded3 Set correct CMake octopi version 2020-10-04 21:58:55 +02:00
Björn Stresing
5d36b8a957 Introduce CMake build system 2020-10-04 21:39:28 +02:00
529 changed files with 113264 additions and 27097 deletions

12
.gitignore vendored
View File

@@ -1,17 +1,28 @@
*.user
.qmake.stash
.qtc_clangd/**
Makefile
bin/**
build/**
build_dir/**
helper/*.o
helper/.qtc_clangd/**
helper/moc*.*
helper/octphelper
cachecleaner/bin/**
cachecleaner/build/**
cachecleaner/.qtc_clangd/**
notifier/bin/**
notifier/build/**
notifier/.qtc_clangd/**
notifier/.qtc/**
notifier/.cmake/**
notifier/CMakeCache*
notifier/CMakeFiles*
notifier/qtcsettings.cmake
octopi.pro.user
qrc_resources.cpp
repoeditor/.qtc_clangd/**
repoeditor/bin/**
repoeditor/build/**
sudo/*.o
@@ -19,3 +30,4 @@ sudo/moc*.*
sudo/octopi-sudo
sudo/qrc*.cpp
sudo/ui_pass*.h
sudo/.qtc_clangd

View File

@@ -1,9 +1,11 @@
[main]
host = https://www.transifex.com
[octopi.octopi]
file_filter = resources/translations/octopi_<lang>.ts
source_file = resources/translations/octopi_en.ts
source_lang = en
type = QT
[o:arnt:p:octopi:r:octopi]
file_filter = resources/translations/octopi_<lang>.ts
source_file = resources/translations/octopi_en.ts
source_lang = en
type = QT
replace_edited_strings = false
keep_translations = false

248
CHANGELOG
View File

@@ -1,4 +1,190 @@
0.10.0
0.19 (dev)
BugFix: Pressing F11 to maximize bottom panel crashed Octopi if Info tab was selected.
BugFix: Octopi crashed after using AUR/KCP tool and clicking on a package anchor
in Output tab.
BugFix: Optional deps dialog had a column header named "3" instead of "Repository".
BugFix: Some outdated AUR pkgs were not showing on notifier (thanks to urbenlegend).
BugFix: There was a method called more than once every time distro news was checked.
Add the option to make the whole interface text less condensed.
Add the option to show/hide "Repository" and "Download Size" columns in package list.
Add Repository field in Info tab.
Make "Search for outdated AUR packages" a notifier only option.
Enable Check updates and System upgrade tool buttons in AUR mode.
Show current version of the packages on Notifier's System Upgrade dialog
(thanks to valchx's code).
Added chinese description for the application name in desktop file.
Updated translations.
0.18.1 (2025-09-29)
BugFix: French translation was not working properly (thanks to roxfr).
BugFix: Yay searches with version 12.5.2 crashed Octopi (thanks to nije-to-sve).
BugFix: Search for BASH also in "/bin".
BugFix: Force use of BASH shell was not working (thanks to UnsaltedScholar).
BugFix: List of outdated KCP packages was not working in KaOS.
BugFix: Under some conditions Octopi could crash due to shared memory access failures.
Updated translations.
0.18.0 (2025-09-20)
BugFix: The act of moving the mouse over the package list was triggering many
"pacman -Si" executions (thanks to RAZUMNO).
BugFix: Notifier did not fetch updates for the first time when using "once a day".
BugFix: qt-sudo now respects user locale settings (thanks to D10RUS).
BugFix: Use better way to detect if user is running the tools from the right place.
BugFix: Select Help tab when Octopi runs for the first time.
BugFix: Make Actions tab visible when a package is selected for insertion/removal.
BugFix: Use system theme folder icon in Files tab.
BugFix: Package list refresh was not running after a group install/removal.
BugFix: ILoveCandy option was not working 100% in parser.
Search option selected by the user is saved on close.
Added support for garuda-update command when running in Garuda Linux.
Added support for a user specified backup shell script that needs to be placed at
"/usr/lib/octopi/pre-system-upgrade.sh" and executes before the system upgrades.
Added support for pacman.conf's IgnorePkg option through "Add to Ignored" and
"Remove from Ignored" actions from the context menu in the package list.
Added View/Ignored menu option.
Added support for Plus and Minus keys to add and remove packages from the system.
Added "Get Latest distro news" menu item to the News tab context menu.
Added Apply and Cancel buttons also in the Actions tab.
Added "Enable package tooltips" option, so users can disable the feature when needed.
Added "Force use of BASH shell" option to ensure compatibility when the user
uses another SHELL.
Added Tools/pacman-key option to refresh pacman gpg keys.
Modernization of Options dialog.
Updated translations.
0.17.0 (2025-02-18)
BugFix: Code for EndeavourOS news was incomplete (thanks to LegitGreenBoi).
BugFix: Help msg for newer packages was wrong because they're not installed.
Prefer Bash shell (/usr/bin/bash) when executing package commands.
Added "--editmenu" checkbox on Options dialog if you are using Yay tool.
Added option to always use the terminal when executing pacman actions.
Play a bell sound when the Terminal tab is asking for the user password.
Improvement: Let user choose which domain is pinged when checking for internet access
(if ping.archlinux.org is down).
Improvement: Show a "Collecting transaction data..." msg before presenting the transaction
dialog, as it can be quite slow on some systems (thanks to Valdir).
Updated translations.
0.16.2 (2024-06-17)
BugFix: Increased width of Terminal tab labels on Options dialog.
BugFix: Removed a debug msg when octopi was not being executed with "-d".
Updated translations.
0.16.1 (2024-06-09)
BugFix: Updated some LANG environment variables to C.UTF-8.
BugFix: Info/Files tabs were always empty if they were selected at octopi's start.
BugFix: Do not install notifier's desktop file in /etc/xdg/autostart.
BugFix: Could not remove packages when internet connection was down (thanks to Theluga).
Added shortcut key "Ctrl+Shift+U" to upgrade outdated AUR packages.
Arrow keys navegation refresh Info and Files tabs again.
Updated translations.
0.16.0 (2024-05-19)
BugFix: '--noeditmenu' is deprecated. Use '--editmenu=false' instead (thanks to rbaruccojr).
BugFix: Fixed silent error when pacman's database is locked (thanks to SloppyPuppy).
BugFix: Files tab expand all items by default.
BugFix: Updated translations.
Now using the unified qt-sudo project (https://github.com/aarnt/qt-sudo) for privilege escalation.
Default to Qt6 lib build (including qtermwidget6)
0.15.0 (2023-09-10)
BugFix: Invalidate Info/Files tabs when user is navigating packages using the keyboard.
BugFix: Better handle dependencies while staging packages for deletion.
BugFix: First yay-bin download now works again.
BugFix: Polished navigation on Info tab dependencies
BugFix: AUR passwords that contained a "+" char failed to login at aur.archlinux.org.
BugFix: When using the pacman backend, call "pacman -Qm" to fetch ALL foreign packages.
BugFix: Change install reason did not work with pacman backend.
Made the code Qt5/Qt6 compatible.
Using "pacman -Fl" to view contents of non installed packages (thanks to Zesko).
Added a Terminal tab to options dialog to config its colors and fonts.
Octopi-sudo code was synced to match project "lxqt-sudo" version 1.3.0.
0.14.0 (2022-10-05)
Added --overwrite="*" checkbox in AUR tab (Tools/Options) when using yay.
Octopi-sudo code was synced to match project "lxqt-sudo" version 1.1.0.
BugFix: Package search did not work correctly when query string contained a "+" sign.
BugFix: Info/Files tab refresh was duplicated.
BugFix: Disable (another try) Info/Files tab refresh while typing in Filter/Search
line edit.
0.13.0 (2022-03-30)
BugFix: editFile() caused a crash while in Mate desktop. Both "Open PKGBUILD"
and "Show PKGBUILD diff" options were affected.
BugFix: removed stylesheet from treeviews. It makes dark themes look better
(thanks to buckmelanoma).
BugFix: Pressing ENTER over an installed AUR pkg no longer sends it to the
install action treeview.
BugFix: Made Octopi compatible with aurweb 6.x version (view PKGBUILD,
diff PKGBUILD, vote, unvote and list voted AUR).
Added "Outdated" filter/option on menu "View".
Added a "-checkupdates" parameter to Notifier, so users can update the status
of an already running Octopi Notifier.
Added option to update selected outdated AUR pkgs directly from the main list.
0.12.0 (2021-11-06)
Added support for pacman 6.0 (thanks to class101)
Added support for Paru AUR tool.
Added support for opendoas tool (default).
Added support for Archcraft OS.
Added support for Garuda Linux distro.
Added support for Obarun Linux distro.
Actions tab shows a counter feedback for inserts (with a plus signal) and
removals (with a minus signal) and does not steal focus anymore.
Octopi-sudo code was synced to match project "lxqt-sudo" version 1.0.0.
BugFix: Initial database searches are executed after main interface is shown.
This improves UI feedback on older cpus.
BugFix: If there was only 1 result in AUR search, the pkg could not enter
the transaction with the right name.
BugFix: IgnorePkg pkgs are shown as outdated when using ALPM backend.
BugFix: If user went from AUR to normal search with a not found pkg the statusbar
counters would become invisible.
BugFix: If options dialog was called while both notifier and octopi were running,
Updates tab was not shown.
0.11.0 (2021-01-11)
Added support for CMake build system (thanks to Tereius).
Added support to build multiple foreign packages at once (they are first copied
to the Actions' tree view just like official packages).
Added "Open PKGBUILD" option to open the AUR PKGBUILD file in a text editor.
Added "Show PKGBUILD diff" option to show the differences between latest and previous
PKGBUILD files of the selected AUR package in a text editor.
Added "Install Date" at Info tab.
Added "Licenses", "Maintainer", "Depends On", "Make Deps", "Last Modified" and "Out-of-date"
fields at Info tab while in AUR mode.
Added option to display "Licenses", "Installed Size", "Build Date", "Install Date" and
"Install Reason" columns in the package list.
Added option to "Change Install Reason" of selected packages (Explicitly <-> As Dependency).
Added a faster refresh package list code after checking for updates.
Added "Build directory" option in AUR tab on options dialog, so users can change where
makepkg builds the source code.
Added support for '^' and '$' chars in AUR search
Added "Open news in a browser" option on right clicking the News tab.
Optional package dependencies are now installed with "--asdeps" parameter.
Octopi-sudo code was synced to match project "lxqt-sudo" version 0.16.0.
Updated PKGBUILD file following MatMoul's suggestion.
Removed unused speedup service.
Prevent users from running Octopi, Notifier and Cache Cleaner outside "/usr/bin" dir.
BugFix: Disable Info/Files tab refresh while typing in filter/search line edit.
BugFix: unset TMPDIR environment variable on every Octo tool startup
(to avoid "octopi-helper[aborted]: Couldn't attach to memory" errors).
BugFix: "total download size" showed the value 0 in Notifier if the database was not synched.
BugFix: Pressing ESC in repoeditor could ask if you wanted to save your changes even
if there were no changes made.
BugFix: Running Notifier within a DE session could lead to a "Suspicious execution method" error.
BugFix: If you tried to execute octopi after upgrading your system with notifier you got a
notifier crash and an octopi freeze (thanks to linuxer for pointing that out).
BugFix: Prevent icon changes in notifier when there were transaction errors.
BugFix: The list of targets to install were not showing ok in the transaction dialog.
BugFix: Restored support for command line parameters like "-sysupgrade-noconfirm" and "-style".
BugFix: Updated "-help" output text.
BugFix: Tab navigation improvements.
BugFix: Statusbar showed a number of packages when the list was empty (the previous value).
BugFix: Clicking on printed outdated packages in Output tab did not send to corresponding
package in the main list after a 'Check updates'.
BugFix: WM detection now uses "ps -aux".
0.10.0 (2020-07-19)
Added a built-in default priviledge escalation tool: "octopi-sudo" as a slightly modified version
of "lxqt-sudo" project (version 0.15.0). It's the only escalation tool supported!
Added option to vote/unvote for AUR packages using aur.archlinux.org login.
@@ -8,7 +194,7 @@
Added option to download a temporary yay-bin to enable AUR.
Updated some UI icons and added an specific one for foreign non installed pkg.
Dropped support for external terminal applications. QTermWidget is mandatory now!
Print .pacnew list summary after upgrade (if any).
Print ".pacnew" file list summary after upgrade (if any).
Added Lumina desktop support.
RepoEditor now saves window size and position.
Added "copy" command to octopi's embedded terminal context menu.
@@ -56,7 +242,7 @@
BugFix: Enable a more complete UI lockdown during transactions.
BugFix: Enable "Find a file" context menu option on a non installed pkg.
0.9.0
0.9.0 (2018-06-08)
Parser changes: added counter for processed packages.
Group pane now spans all window's height.
SysInfo now uses ptpb site and does not block interface.
@@ -112,7 +298,7 @@
BugFix: Disable alien icon while in transaction.
BugFix: Do not ask twice for password if a pacman lck file exists.
0.8.1
0.8.1 (2016-03-27)
BugFix: Updated CHAKRA RSS site (thanks to s8321414).
BugFix: Distro news now works with https KaOS site.
BugFix: Files tab was not refreshing when enabling KCP mode in KaOS.
@@ -135,7 +321,7 @@
Added support for lxqt-sudo tool (thanks to Manjaro team).
Added "pkgfile -u" (if available) in sync db transaction.
0.8.0
0.8.0 (2015-11-08)
This is a Qt5 only version (with the exception of 'octopi-notifier').
BugFix: Speed optimizations in startup code (AUR outdated list).
BugFix: Octopi now honors the $SHELL variable (thanks to LAC1213).
@@ -166,7 +352,7 @@
Help/About dialog now shows Pacman information.
StatusBar msg got updated with number of selected packages more visible.
0.7.0
0.7.0 (2015-04-27)
Major speed fix: Faster pkg list building.
Reverted to showing ALL packages at startup.
Added a systemd service to speed up the very first octopi startup time.
@@ -196,7 +382,7 @@
BugFix: If user had no gksu/kdesu/root when clicking "clean" button in
cachecleaner, cursor would remain waiting (thanks to imperator-).
0.6.0
0.6.0 (2015-02-27)
BugFix: Pkg list was being refreshed twice sometimes.
BugFix: Removed some buggy strings from Output tab while in KF5.
BugFix: ArrowUp/Down, PageUp/Down and Home/End keys now refresh Package Info tab.
@@ -224,7 +410,7 @@
Refactorings in SearchLineEdit.
BugFixes in RepoEditor translation support (repoeditor is now in Transifex too).
0.5.0
0.5.0 (2014-11-08)
BugFix: RepoEditor would not compile with Qt5 lib (thanks to Philm).
BugFix: Suppress GConf error strings in output.
BugFix: mate-terminal is returning code 255 even when execution of
@@ -250,14 +436,14 @@
Added support for KStatusNotifier while in KDE (thanks to brcha).
Updated translations.
0.4.2
0.4.2 (2014-07-26)
BugFix: when searching AUR pkgs, given search string was not being matched
by package descriptions.
BugFix: Sometimes got a gconf bug string at sync db.
Updated a bunch of translations.
Added support for the new kcp tool (Go version).
0.4.1
0.4.1 (2014-07-12)
Added basque translation (thanks to tarteka).
Added es_AR translation (thanks to javier).
Added japanese translation (thanks to UTUMI Hirosi - utuhiro78).
@@ -285,7 +471,7 @@
Added Search by file feature (pacman -Qo).
Added a string validator in the search edit widget.
0.4.0
0.4.0 (2014-05-24)
Huge refactorings in model/view that brings consistent memory and
speed improvements - a single model and a central data storage (thanks to
Thomas Binkau - tbinkau).
@@ -339,7 +525,7 @@
Fixed getBuildDate code to always convert dates to english format.
Updated some translations.
0.3.2
0.3.2 (2014-02-14)
Cleaned unused code.
Added icon for mirror-check while in KaOS.
Does a mirror-check at startup while in KaOS.
@@ -354,7 +540,7 @@
BugFix: When the user had no yaourt in the system, there were a zombie
octopi process 'left running'.
0.3.1
0.3.1 (2014-01-14)
Added support for Qt5.
Added chinese (Taiwan), malay, slovak and ukrainian translations.
Added support to KaOS, a lean KDE centric Linux distro.
@@ -365,7 +551,7 @@
first searches into transaction queue for them.
BugFix: Prevent header resizing in File and Transaction tabs.
0.3
0.3.0 (2013-11-03)
Code cleanings.
BugFix: No need to refresh package list after a cache clean.
BugFix: Konsole was not working with yaourt package installation.
@@ -412,7 +598,7 @@
Added an About Dialog to Octopi Notifier.
Updated translations.
0.2
0.2.0 (2013-08-24)
Splitted the project in "octopi" and "octopi-notifier".
Yaourt no longer runs with root permissions.
Added support for package multi selection in Yaourt mode.
@@ -433,23 +619,23 @@
IgnorePkg option is now used to build outdated package list.
BugFix: Empty pkg descriptions are now shown as empty.
0.1.9.1
0.1.9.1 (2013-07-14)
Important bugfixes to deal with multithreaded code.
Added a "globals.h/.cpp" file to group QFutureWatcher globals.
Updated style changing code in main.cpp.
BugFix: when user cancelled a sysupgrade transaction inside a
terminal, the package actions remained disabled.
0.1.9
0.1.9 (2013-07-09)
Added yaourt support.
Updated most of the translations.
0.1.8
0.1.8 (2013-06-16)
Added czech translation.
Added support to ArchBang Linux.
Added a systemtray icon notifier feature using DBus technology.
0.1.7.3
0.1.7.3 (2013-05-26)
Added a TRANSLATIONS file.
Added danish translation.
Added indonesian translation.
@@ -459,14 +645,14 @@ terminal, the package actions remained disabled.
Bugfix: sysupgrade must refresh packagelist after syncdatabase.
Bugfix: if sysupgrade uses SyncFirst, makes it automatically start a second upgrade.
0.1.7.2
0.1.7.2 (2013-05-17)
Added catalan translation.
Bugfix: updated new binary translation files to the resources.
0.1.7.1
0.1.7.1 (2013-05-11)
Bugfix: menu icons were not being shown while in Xfce.
0.1.7
0.1.7 (2013-05-11)
Added "-sysupgrade" command line option.
Added "-removecmd" command line option.
Added lots of translations.
@@ -474,11 +660,11 @@ terminal, the package actions remained disabled.
Added an About dialog.
Changed the old About tab to Usage tab.
0.1.6.1
0.1.6.1 (2013-04-25)
Added pt_BR translation.
Added "Open root terminal" option in File menu.
0.1.6
0.1.6 (2013-04-12)
Added a new Transaction Dialog.
Added a Firefox-like search inside Files, News and About tabs.
Added support for Chakra.
@@ -486,33 +672,33 @@ terminal, the package actions remained disabled.
Added option to execute any transaction inside a terminal.
Changed ProgressDialog to a progressBar at the screen bottom.
0.1.5
0.1.5 (2013-04-06)
Added option to search packages by description and name.
Added support for pacman version 4.1.
Transactions with conflict errors can be re-executed inside a terminal.
Reworked Manjaro Linux theme.
0.1.4.1
0.1.4.1 (2013-03-30)
Bugfix release
Added total download size information in transaction dialog.
0.1.4
0.1.4 (2013-03-28)
Added a Manjaro Linux theme.
Changed position of filter line edit to the toolbar.
0.1.3
0.1.3 (2013-03-19)
Added better support to Qt dark themes.
Added context menu support inside Files tab.
Made URLs clickable inside Output tab.
Fixed the annoying Packager information display bug.
0.1.2
0.1.2 (2013-03-18)
Tons of refactorings and bugfixes.
Small changes in UI.
0.1.1
0.1.1 (2013-03-17)
Added all six tabs.
Added support for groups of packages.
0.1.0
0.1.0 (2013-03-11)
Initial Proof of Concept release.

130
CMakeLists.txt Normal file
View File

@@ -0,0 +1,130 @@
cmake_minimum_required(VERSION 3.5)
project(octopi VERSION 0.19.0 LANGUAGES CXX)
set(CMAKE_CXX_STANDARD 17)
set(CMAKE_CXX_STANDARD_REQUIRED ON)
set(CMAKE_THREAD_PREFER_PTHREAD True)
set(CMAKE_RUNTIME_OUTPUT_DIRECTORY "${CMAKE_CURRENT_BINARY_DIR}")
option(USE_QTERMWIDGET6 "Build with qtermwidget6 instead of qtermwidget5" ON)
add_subdirectory(helper)
add_subdirectory(notifier)
add_subdirectory(cachecleaner)
add_subdirectory(repoeditor)
if (USE_QTERMWIDGET6)
find_package(Qt6 REQUIRED COMPONENTS Core Core5Compat Gui Network Xml Widgets LinguistTools Multimedia)
find_package(qtermwidget6 REQUIRED)
else()
find_package(Qt5 REQUIRED COMPONENTS Core Gui Network Xml Widgets LinguistTools Multimedia)
find_package(qtermwidget5 REQUIRED)
endif()
find_package(alpm_octopi_utils REQUIRED)
set(CMAKE_AUTOMOC ON)
file(GLOB TS_FILES LIST_DIRECTORIES false "${CMAKE_CURRENT_LIST_DIR}/resources/translations/*.ts")
qt_add_translation(qmFiles ${TS_FILES})
set(src
src/QtSolutions/qtsingleapplication.cpp
src/QtSolutions/qtlocalpeer.cpp
repoeditor/repoentry.cpp
src/aurvote.cpp
src/propertiestabwidget.cpp
src/qaesencryption.cpp
src/repoconf.cpp
src/main.cpp
src/mainwindow.cpp
src/strconstants.cpp
src/searchlineedit.cpp
src/argumentlist.cpp
src/settingsmanager.cpp
src/package.cpp
src/unixcommand.cpp
src/wmhelper.cpp
src/treeviewpackagesitemdelegate.cpp
src/mainwindow_init.cpp
src/mainwindow_transaction.cpp
src/mainwindow_events.cpp
src/mainwindow_help.cpp
src/searchbar.cpp
src/mainwindow_searchbar.cpp
src/transactiondialog.cpp
src/mainwindow_news.cpp
src/mainwindow_refresh.cpp
src/globals.cpp
src/multiselectiondialog.cpp
src/packagerepository.cpp
src/model/packagemodel.cpp
src/ui/octopitabinfo.cpp
src/utils.cpp
src/terminal.cpp
src/pacmanexec.cpp
src/optionsdialog.cpp
src/packagetreeview.cpp
src/termwidget.cpp
src/alpmbackend.cpp)
set(header
src/QtSolutions/qtsingleapplication.h
src/QtSolutions/qtlocalpeer.h
repoeditor/repoentry.h
src/aurvote.h
src/propertiestabwidget.h
src/qaesencryption.h
src/repoconf.h
src/mainwindow.h
src/strconstants.h
src/searchlineedit.h
src/argumentlist.h
src/settingsmanager.h
src/uihelper.h
src/package.h
src/unixcommand.h
src/wmhelper.h
src/treeviewpackagesitemdelegate.h
src/searchbar.h
src/transactiondialog.h
src/globals.h
src/multiselectiondialog.h
src/packagerepository.h
src/model/packagemodel.h
src/ui/octopitabinfo.h
src/utils.h
src/terminal.h
src/pacmanexec.h
src/constants.h
src/optionsdialog.h
src/packagetreeview.h
src/termwidget.h
src/alpmbackend.h)
set(ui ui/mainwindow.ui ui/transactiondialog.ui ui/multiselectiondialog.ui ui/optionsdialog.ui)
set(qrc resources.qrc)
qt_wrap_ui(src ${ui})
qt_add_resources(src ${qrc})
add_executable(octopi ${src} ${header} ${qmFiles})
target_compile_definitions(octopi PRIVATE OCTOPI_EXTENSIONS ALPM_BACKEND QT_DEPRECATED_WARNINGS QT_USE_QSTRINGBUILDER QT_NO_CAST_FROM_ASCII QT_NO_CAST_TO_ASCII QT_NO_URL_CAST_FROM_STRING QT_NO_CAST_FROM_BYTEARRAY)
if (USE_QTERMWIDGET6)
target_include_directories(octopi PRIVATE ${CMAKE_CURRENT_SOURCE_DIR} ${CMAKE_CURRENT_BINARY_DIR} ${Qt6Core_INCLUDE_DIRS} ${Qt6Gui_INCLUDE_DIRS} ${Qt6Network_INCLUDE_DIRS} ${Qt6Xml_INCLUDE_DIRS} ${Qt6Widgets_INCLUDE_DIRS})
target_link_libraries(octopi PRIVATE Qt6::Core Qt6::Gui Qt6::Network Qt6::Xml Qt6::Widgets Qt6::Multimedia qtermwidget6 alpm_octopi_utils)
else()
target_include_directories(octopi PRIVATE ${CMAKE_CURRENT_SOURCE_DIR} ${CMAKE_CURRENT_BINARY_DIR} ${Qt5Core_INCLUDE_DIRS} ${Qt5Gui_INCLUDE_DIRS} ${Qt5Network_INCLUDE_DIRS} ${Qt5Xml_INCLUDE_DIRS} ${Qt5Widgets_INCLUDE_DIRS})
target_link_libraries(octopi PRIVATE Qt5::Core Qt5::Gui Qt5::Network Qt5::Xml Qt5::Widgets Qt5::Multimedia qtermwidget5 alpm_octopi_utils)
endif()
file(COPY "${CMAKE_CURRENT_SOURCE_DIR}/resources/images/octopi_green.png" DESTINATION "${CMAKE_CURRENT_BINARY_DIR}")
file(RENAME "${CMAKE_CURRENT_BINARY_DIR}/octopi_green.png" "${CMAKE_CURRENT_BINARY_DIR}/octopi.png")
install(TARGETS octopi RUNTIME DESTINATION bin LIBRARY DESTINATION lib PUBLIC_HEADER DESTINATION include)
install(FILES "${CMAKE_CURRENT_SOURCE_DIR}/octopi.desktop" DESTINATION share/applications)
install(FILES "${CMAKE_CURRENT_BINARY_DIR}/octopi.png" "${CMAKE_CURRENT_SOURCE_DIR}/resources/images/octopi_green.png" DESTINATION share/icons/hicolor/48x48/apps)
install(FILES "${CMAKE_CURRENT_BINARY_DIR}/octopi.png" "${CMAKE_CURRENT_SOURCE_DIR}/resources/images/octopi_green.png"
"${CMAKE_CURRENT_SOURCE_DIR}/resources/images/octopi_red.png" "${CMAKE_CURRENT_SOURCE_DIR}/resources/images/octopi_yellow.png" DESTINATION share/icons/hicolor/48x48/apps)
install(FILES "${CMAKE_CURRENT_SOURCE_DIR}/LICENSE" DESTINATION share/licenses/octopi)

View File

@@ -1,77 +1,53 @@
pkgname=octopi
pkgver=0.10.0
_pkgname=octopi
pkgname=octopi-git
pkgver=0.19.0.latest
pkgrel=1
pkgdesc="This is Octopi, a powerful Pacman frontend using Qt libs"
pkgdesc="This is Octopi, a powerful Pacman frontend using Qt libs (git checkout)"
url="https://tintaescura.com/projects/octopi/"
arch=('i686' 'x86_64')
license=('GPL2')
depends=('alpm_octopi_utils' 'pkgfile' 'qtermwidget' 'sudo')
depends=('alpm_octopi_utils' 'qtermwidget' 'sudo')
makedepends=('git')
groups=('system')
install=octopi.install
source=("git+https://github.com/aarnt/octopi.git")
md5sums=('SKIP')
prepare() {
cd "${pkgname}"
# enable the kstatus switch, disable if you wish to build without Plasma/knotifications support
sed -e "s|DEFINES += ALPM_BACKEND #KSTATUS|DEFINES += ALPM_BACKEND KSTATUS|" -i notifier/octopi-notifier.pro
cd "${_pkgname}"
cp resources/images/octopi_green.png resources/images/octopi.png
}
#pkgver() {
# cd "${_pkgname}"
# git describe --long --tags --abbrev=7 | sed 's/\([^-]*-g\)/r\1/;s/-/./g;s/^v//'
#}
build() {
cd "${pkgname}"
qmake-qt5 PREFIX=/usr QMAKE_CFLAGS="${CFLAGS}" QMAKE_CXXFLAGS="${CXXFLAGS}" QMAKE_LFLAGS="${LDFLAGS}" octopi.pro
cd "${_pkgname}"
echo "Starting build..."
qmake6 PREFIX=/usr QMAKE_CFLAGS="${CFLAGS}" QMAKE_CXXFLAGS="${CXXFLAGS}" QMAKE_LFLAGS="${LDFLAGS}" octopi.pro
make
cd helper
qmake-qt5 PREFIX=/usr QMAKE_CFLAGS="${CFLAGS}" QMAKE_CXXFLAGS="${CXXFLAGS}" QMAKE_LFLAGS="${LDFLAGS}" octopi-helper.pro
make
cd ..
_subdirs="cachecleaner helper notifier repoeditor"
cd notifier
qmake-qt5 PREFIX=/usr QMAKE_CFLAGS="${CFLAGS}" QMAKE_CXXFLAGS="${CXXFLAGS}" QMAKE_LFLAGS="${LDFLAGS}" octopi-notifier.pro
make
cd ..
cd repoeditor
qmake-qt5 PREFIX=/usr QMAKE_CFLAGS="${CFLAGS}" QMAKE_CXXFLAGS="${CXXFLAGS}" QMAKE_LFLAGS="${LDFLAGS}" octopi-repoeditor.pro
make
cd ..
cd cachecleaner
qmake-qt5 PREFIX=/usr QMAKE_CFLAGS="${CFLAGS}" QMAKE_CXXFLAGS="${CXXFLAGS}" QMAKE_LFLAGS="${LDFLAGS}" octopi-cachecleaner.pro
make
cd ..
cd sudo
qmake-qt5 PREFIX=/usr QMAKE_CFLAGS="${CFLAGS}" QMAKE_CXXFLAGS="${CXXFLAGS}" QMAKE_LFLAGS="${LDFLAGS}" octopi-sudo.pro
make
for _subdir in $_subdirs; do
pushd $_subdir
echo "Building octopi-$_subdir..."
qmake6 PREFIX=/usr QMAKE_CFLAGS="${CFLAGS}" QMAKE_CXXFLAGS="${CXXFLAGS}" QMAKE_LFLAGS="${LDFLAGS}" "octopi-$_subdir.pro"
make
popd
done
}
package() {
cd "${pkgname}"
cd "${_pkgname}"
make INSTALL_ROOT="${pkgdir}" install
cd helper
make INSTALL_ROOT="${pkgdir}" install
cd ..
_subdirs="cachecleaner helper notifier repoeditor"
cd notifier
make INSTALL_ROOT="${pkgdir}" install
cd ..
cd repoeditor
make INSTALL_ROOT="${pkgdir}" install
cd ..
cd cachecleaner
make INSTALL_ROOT="${pkgdir}" install
cd ..
cd sudo
make INSTALL_ROOT="${pkgdir}" install
for _subdir in $_subdirs; do
pushd $_subdir
make INSTALL_ROOT="${pkgdir}" install
popd
done
}

102
README.md
View File

@@ -1,29 +1,32 @@
## This is Octopi, a powerful Pacman/AUR front end using Qt libs.
![Main window](https://raw.githubusercontent.com/aarnt/octopi/master/octopi-mainwindow.png)
![Options dialog](https://raw.githubusercontent.com/aarnt/octopi/master/octopi-optionsdialog.png)
![Main window with qss](https://raw.githubusercontent.com/aarnt/octopi/master/octopi-mainwindow-with-qss.png)
The project site is hosted on https://tintaescura.com/projects/octopi
Currently, 10 Linux distros are compatible with it
Currently, 11 Linux distros are compatible with it
* [ArchBang](http://archbang.org/)
* [Archcraft](https://archcraft.io/)
* [Arch Linux](https://www.archlinux.org/)
* [ArcoLinux](https://arcolinux.info/)
* [Artix Linux](https://artixlinux.org)
* [Chakra](https://chakralinux.org/)
* [CondresOS](https://condresos.codelinsoft.it/)
* [CachyOS](https://cachyos.org/)
* [EndeavourOS](https://endeavouros.com/)
* [Garuda Linux](https://garudalinux.org/)
* [KaOS](https://kaosx.us/)
* [Manjaro](https://manjaro.org/)
* [Parabola GNU/Linux-libre](https://www.parabola.nu/)
* [Obarun Linux](https://web.obarun.org/index.php?id=1)
### What you must install in order to have Octopi fully functional
You'll need:
* [Alpm_octopi_utils](https://github.com/aarnt/alpm_octopi_utils/) library
* A helper to execute pacman commands called "octphelper", available on "./helper" dir
* A priviledge escalation tool called "octopi-sudo", available on "./sudo" dir
* qtermwidget >= 0.14.1 in order to build Octopi with embedded terminal support
* A privilege escalation tool called [qt-sudo](https://github.com/aarnt/qt-sudo/)
* qtermwidget package, in order to build Octopi with embedded terminal support
### To install Octopi using pacman
@@ -33,9 +36,9 @@ If Octopi package is available in your distro's repository, you can just type:
# pacman -S octopi
```
### Steps to build Octopi source code
### Steps to build Octopi source code (qmake)
Assuming you have vala compiler and Qt5 libs properly installed, follow these steps:
Assuming you have vala compiler and Qt6 libs properly installed, follow these steps:
```
$ git clone https://github.com/aarnt/alpm_octopi_utils
@@ -43,40 +46,70 @@ $ cd alpm_octopi_utils
$ make
# make install
$ cd ..
$ git clone https://github.com/aarnt/octopi
$ cd octopi/sudo
$ qmake-qt5
$ make
# make install
$ cd ../helper
$ qmake-qt5
$ make
# make install
$ cd ../notifier
$ qmake-qt5
$ make
# make install
$ cd ../cachecleaner
$ qmake-qt5
$ make
# make install
$ cd ../repoeditor
$ qmake-qt5
$ git clone https://github.com/aarnt/qt-sudo
$ cd qt-sudo
$ qmake6
$ make
# make install
$ cd ..
$ qmake-qt5
$ git clone https://github.com/aarnt/octopi
$ cd octopi/helper
$ qmake6
$ make
# make install
$ cd ../notifier
$ qmake6
$ make
# make install
$ cd ../cachecleaner
$ qmake6
$ make
# make install
$ cd ../repoeditor
$ qmake6
$ make
# make install
$ cd ..
$ qmake6
$ make
# make install
```
You can also use the available PKGBUILD script that helps you build Octopi with all its tools:
You can also use the available PKGBUILD script that helps you build latest Octopi development version with all its tools(*):
```
$ cd OCTOPI_PATH (where you git cloned the source code)
$ makepkg -f
```
(*) It may contain bugs. You have been warned.
### Steps to build Octopi source code (CMake)
As an alternative to qmake, Octopi can also be built with CMake. Make sure that at least CMake 3.5 is installed.
First, build and install alpm_octopi_utils:
```
$ git clone https://github.com/aarnt/alpm_octopi_utils
$ cd alpm_octopi_utils
$ mkdir build_dir && cd build_dir
$ cmake -G "Unix Makefiles" .. -DCMAKE_BUILD_TYPE=Release -DCMAKE_INSTALL_PREFIX=/usr
$ make
$ sudo make install
```
Next, build and install Octopi:
```
$ git clone https://github.com/aarnt/octopi
$ cd octopi
$ mkdir build_dir && cd build_dir
$ cmake -G "Unix Makefiles" .. -DCMAKE_BUILD_TYPE=Release -DCMAKE_INSTALL_PREFIX=/usr
$ make
$ sudo make install
```
### To run Octopi
```
@@ -91,23 +124,24 @@ $ /usr/bin/octopi-notifier
### To enable AUR support (that "green alien" icon on toolbar)
You'll need to install [pacaur](https://github.com/rmarquis/pacaur),
You'll need to install [pacaur](https://github.com/rmarquis/pacaur), [paru](https://github.com/morganamilo/paru),
[pikaur](https://github.com/actionless/pikaur), [trizen](https://github.com/trizen/trizen) or
[yay](https://github.com/Jguer/yay) in your system.
If neither of the previous tools are found Octopi will download latest "yay-bin" github binary.
In Chakra, [chaser](https://github.com/ccr-tools/chaser) will be supported out of the box.
In KaOS, [kcp](https://github.com/bvaudour/kcp) will be supported out of the box.
In KaOS, [kcp](https://codeberg.org/bvaudour/kcp) will be supported out of the box.
### Ways to help/support Octopi
* You can "Star" it on the Github page - https://github.com/aarnt/octopi/
* You can vote in the AUR package available on https://aur.archlinux.org/packages/octopi/
* You can translate it to your mother language on https://www.transifex.com/projects/p/octopi/
* You can translate it to your mother language on https://explore.transifex.com/arnt/octopi/
* You can follow author's twitter account on https://twitter.com/aaarnt
* You can buy author's technical book (currently in portuguese) about Octopi and Qt5 on
http://www.amazon.com.br/Aprendendo-Qt-com-projeto-Octopi-ebook/dp/B015ICHKV6
* You can buy author's poem book (currently in portuguese) on meditation, Buddhism, cosmology and other subjects on
https://www.amazon.com.br/Avidya-Alexandre-Arnt-ebook/dp/B0965LVWR3
* You can write a review about it (text / video)
* You can donate money to the project Paypal - http://sourceforge.net/donate/index.php?group_id=186459
* You can donate money to the author's Paypal - http://sourceforge.net/donate/index.php?group_id=186459
* You can join the project ;-)

View File

@@ -1,9 +1,11 @@
[main]
host = https://www.transifex.com
[octopi.cachecleaner]
file_filter = resources/translations/octopi_cachecleaner_<lang>.ts
source_file = resources/translations/octopi_cachecleaner_en.ts
source_lang = en
type = QT
[o:arnt:p:octopi:r:cachecleaner]
file_filter = resources/translations/octopi_cachecleaner_<lang>.ts
source_file = resources/translations/octopi_cachecleaner_en.ts
source_lang = en
type = QT
replace_edited_strings = false
keep_translations = false

View File

@@ -0,0 +1,66 @@
if (USE_QTERMWIDGET6)
find_package(Qt6 REQUIRED COMPONENTS Core Network Xml Widgets LinguistTools)
else()
find_package(Qt5 REQUIRED COMPONENTS Core Network Xml Widgets LinguistTools)
endif()
set(CMAKE_AUTOMOC ON)
file(GLOB TS_FILES LIST_DIRECTORIES false "${CMAKE_CURRENT_LIST_DIR}/resources/translations/*.ts")
qt_add_translation(qmFiles ${TS_FILES})
set(src
main.cpp
cachecleaner.cpp
packagegroupmodel.cpp
../src/strconstants.cpp
../src/qaesencryption.cpp
../src/unixcommand.cpp
../src/wmhelper.cpp
../src/terminal.cpp
../src/settingsmanager.cpp
../src/searchlineedit.cpp
../src/utils.cpp
../src/package.cpp
../src/QtSolutions/qtsingleapplication.cpp
../src/QtSolutions/qtlocalpeer.cpp
#../src/QtSolutions/qtlockedfile.cpp
../src/QtSolutions/qtsinglecoreapplication.cpp)
set(header
cachecleaner.h
packagegroupmodel.h
../src/strconstants.h
../src/qaesencryption.h
../src/unixcommand.h
../src/wmhelper.h
../src/terminal.h
../src/settingsmanager.h
../src/searchlineedit.h
../src/utils.h
../src/package.h
../src/QtSolutions/qtsingleapplication.h
../src/QtSolutions/qtlocalpeer.h
#../src/QtSolutions/qtlockedfile.h
../src/QtSolutions/qtsinglecoreapplication.h)
set(ui ui/cachecleaner.ui)
set(qrc resources.qrc)
qt_wrap_ui(src ${ui})
qt_add_resources(src ${qrc})
add_executable(octopi-cachecleaner ${src} ${header} ${qmFiles})
target_compile_definitions(octopi-cachecleaner PRIVATE QT_USE_QSTRINGBUILDER QT_NO_CAST_FROM_ASCII QT_NO_CAST_TO_ASCII QT_NO_URL_CAST_FROM_STRING QT_NO_CAST_FROM_BYTEARRAY)
if (USE_QTERMWIDGET6)
target_include_directories(octopi-cachecleaner PRIVATE ${CMAKE_CURRENT_BINARY_DIR} "${CMAKE_CURRENT_SOURCE_DIR}/src/QtSolutions" ${Qt6Core_INCLUDE_DIRS} ${Qt6Network_INCLUDE_DIRS} ${Qt6Xml_INCLUDE_DIRS} ${Qt6Widgets_INCLUDE_DIRS})
target_link_libraries(octopi-cachecleaner PRIVATE Qt6::Core Qt6::Network Qt6::Xml Qt6::Widgets)
else()
target_include_directories(octopi-cachecleaner PRIVATE ${CMAKE_CURRENT_BINARY_DIR} "${CMAKE_CURRENT_SOURCE_DIR}/src/QtSolutions" ${Qt5Core_INCLUDE_DIRS} ${Qt5Network_INCLUDE_DIRS} ${Qt5Xml_INCLUDE_DIRS} ${Qt5Widgets_INCLUDE_DIRS})
target_link_libraries(octopi-cachecleaner PRIVATE Qt5::Core Qt5::Network Qt5::Xml Qt5::Widgets)
endif()
install(TARGETS octopi-cachecleaner RUNTIME DESTINATION bin LIBRARY DESTINATION lib PUBLIC_HEADER DESTINATION include)
install(FILES "${CMAKE_CURRENT_SOURCE_DIR}/octopi-cachecleaner.desktop" DESTINATION share/applications)

View File

@@ -98,7 +98,7 @@ void CacheCleaner::onSendInfoToOctopiHelper()
QString msg;
QByteArray block;
QDataStream out(&block, QIODevice::WriteOnly);
out.setVersion(QDataStream::Qt_5_10);
out.setVersion(QDataStream::Qt_5_15);
//Is octopi-helper running?
bool isHelperExecuting=UnixCommand::isOctopiHelperRunning();

View File

@@ -19,7 +19,7 @@ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
*/
#include "cachecleaner.h"
#include "../../src/strconstants.h"
#include "../src/strconstants.h"
#include "../src/QtSolutions/qtsingleapplication.h"
#include <QApplication>
@@ -31,6 +31,7 @@ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
int main( int argc, char *argv[] )
{
unsetenv("TMPDIR");
QtSingleApplication app( QStringLiteral("Cache Cleaner - Octopi"), argc, argv );
//If there is already an instance running...
@@ -43,18 +44,23 @@ int main( int argc, char *argv[] )
app.sendMessage(QStringLiteral("RAISE"));
QTranslator appTranslator;
appTranslator.load(QLatin1String(":/resources/translations/octopi_cachecleaner_") +
bool success = appTranslator.load(QLatin1String(":/resources/translations/octopi_cachecleaner_") +
QLocale::system().name());
if (!success)
{
success = appTranslator.load(QStringLiteral(":/resources/translations/octopi_cachecleaner_en.qm"));
}
app.installTranslator(&appTranslator);
if (UnixCommand::isRootRunning()){
QMessageBox::critical( 0, StrConstants::getApplicationName(), StrConstants::getErrorRunningWithRoot());
QMessageBox::critical( nullptr, StrConstants::getApplicationName(), StrConstants::getErrorRunningWithRoot());
return (-2);
}
if (!UnixCommand::hasTheExecutable(QStringLiteral("paccache")))
{
QMessageBox::critical( 0, StrConstants::getApplicationName(), StrConstants::getExecutableCouldNotBeFound().arg(QStringLiteral("\"paccache\"")));
QMessageBox::critical( nullptr, StrConstants::getApplicationName(), StrConstants::getExecutableCouldNotBeFound().arg(QStringLiteral("\"paccache\"")));
return (-3);
}
@@ -70,6 +76,12 @@ int main( int argc, char *argv[] )
return (-5);
}
if (!UnixCommand::isOctoToolRunning(QStringLiteral("octopi-cachecleaner")))
{
QMessageBox::critical(nullptr, StrConstants::getApplicationName(), StrConstants::getErrorRunOctopiCacheCleanerAsUsrBin());
return (-6);
}
CacheCleaner w;
if (w.startServer())
{

View File

@@ -7,3 +7,5 @@ Type=Application
Categories=GNOME;GTK;System;
#NotShowIn=GNOME;XFCE;LXDE;KDE;
StartupNotify=true
Version=1.5
SingleMainWindow=true

View File

@@ -106,7 +106,8 @@ TRANSLATIONS += resources/translations/octopi_cachecleaner_pt_BR.ts \
resources/translations/octopi_cachecleaner_hr.ts \
resources/translations/octopi_cachecleaner_zh-Hans.ts \
resources/translations/octopi_cachecleaner_zh_CN.ts \
resources/translations/octopi_cachecleaner_ko.ts
resources/translations/octopi_cachecleaner_ko.ts \
resources/translations/octopi_cachecleaner_ko_KR.ts \
# install
isEmpty(PREFIX) {

View File

@@ -38,7 +38,7 @@ PackageGroupModel::PackageGroupModel(QString optionsString,
QSpinBox *spinner,
QPushButton *refreshBtn,
QPushButton *cleanBtn)
: QObject(NULL),
: QObject(nullptr),
m_optionsString(optionsString),
m_listView(listView),
m_spinner(spinner),
@@ -70,7 +70,7 @@ PackageGroupModel::PackageGroupModel(QString optionsString,
*/
PackageGroupModel::~PackageGroupModel()
{
UnixCommand::removeSharedMemFiles();
//UnixCommand::removeSharedMemFiles();
delete m_acc;
delete m_cmd;
}
@@ -100,7 +100,7 @@ void PackageGroupModel::keepArchivesChanged()
*/
QString PackageGroupModel::getOptions()
{
return m_optionsString + QLatin1String("-k ") + QString::number(m_spinner->value());
return QStringLiteral("%1-k %2").arg(m_optionsString).arg(m_spinner->value());
}
/*
@@ -144,7 +144,7 @@ bool PackageGroupModel::isSUAvailable()
return true;
}
else if (WMHelper::getSUCommand() == ctn_NO_SU_COMMAND){
QMessageBox::critical( 0, StrConstants::getApplicationName(),
QMessageBox::critical( nullptr, StrConstants::getApplicationName(),
StrConstants::getErrorNoSuCommand() +
QLatin1String("\n") + StrConstants::getYoullNeedSuFrontend());
return false;
@@ -158,7 +158,11 @@ bool PackageGroupModel::isSUAvailable()
*/
void PackageGroupModel::cleanCache()
{
if (isExecutingCommand || UnixCommand::isPacmanDbLocked()) return;
if (isExecutingCommand || UnixCommand::isPacmanDbLocked()){
QMessageBox::critical( nullptr, StrConstants::getApplicationName(),
StrConstants::getErrorDbLock());
return;
}
if (!isSUAvailable())
return;
@@ -195,7 +199,7 @@ void PackageGroupModel::finishedDryrun(int exitCode, QProcess::ExitStatus)
if(exitCode > 1)
{
//process failed, provide info on errors
QMessageBox::critical(m_listView, QStringLiteral("Error whith the underlying process"), m_acc->getErrors());
QMessageBox::critical(m_listView, QStringLiteral("Error with the underlying process"), m_acc->getErrors());
}
else if (exitCode == 0)
{
@@ -251,7 +255,7 @@ void PackageGroupModel::processDryrunResult(QString output) {
//process package list
for(int i = 0; i < lines.length(); i++)
{
QString line = lines.at(i);
const QString& line = lines.at(i);
if(i == 0)
//skip the first line ("==> Candidate packages:")

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="af" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="af_ZA" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="be" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="be_BY" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -4,12 +4,12 @@
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Чистач на кеш памет - Octopi</translation>
<translation>Почистване на кеша - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Деинсталирани пакети</translation>
<translation>Премахнати пакети</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="bs" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="bs_BA" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Keš čistač - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Deinstalirani paketi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>Zadrži</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation>Zadržati broj starih verzija</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Osvježi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>Instalirani paketi</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>Očisti</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>Očisti %1</translation>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="cmn" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="cs_CZ" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -4,7 +4,7 @@
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Cache säubern - Octopi</translation>
<translation>Zwischenspeicher säubern - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="de_AT" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="de_DE" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="en_CZ" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="en_IN" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="en_PL" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="en_SE" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="eo" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Malinstalitaj Pakaĵoj</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>Konservi :</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Refreŝigi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>Instalitaj Pakaĵoj</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>Purigi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>Purigi %1</translation>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="es" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Limpiador de caché</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Paquetes desinstalados</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>Mantener:</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation>Número de versiones antiguas a mantener</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Refrescar</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>Paquetes instalados</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>Limpiar</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>Limpiar %1</translation>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="es_CL" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Limpiador Cache-Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Paquetes desinstalados</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>Mantener :</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation>Número de versiones anteriores a mantener</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Refrescar</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>Paquetes instalados</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>Limpiar</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>Limpiar %1</translation>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="es_CR" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="es_MX" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Limpiador de Caché - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Paquetes desinstalados</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>Conservar:</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation>Número de versión anterior a conservar</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Actualizar</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>Paquetes instalados</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>Limpiar</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>Limpiar %1</translation>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="es_NI" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="es_PE" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Borrar Cache - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Refrescar</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>Borrar</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="fa_IR" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Cache Cleaner - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>بسته های حذف شده</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>نگهداری</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation>تعداد ورژنهایی که باقی میمانند</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>تازه سازی</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>بسته های نصب شده</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>تمیز کردن</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>پاک کردن 1%</translation>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="fr_CA" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="fr_CH" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Nettoyeur de cache - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Paquets non-installés</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>Conserver :</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation>Nombre d&apos;anciennes versions à conserver</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Actualiser</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>Paquets installés</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>Nettoyer</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>Nettoyer %1</translation>
</message>
</context>
</TS>

View File

@@ -4,7 +4,7 @@
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Octopi cache tisztítása</translation>
<translation>Gyorsítótár-tisztító - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
@@ -15,7 +15,7 @@
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>Megtart:</translation>
<translation>Megtartás:</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="id_ID" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Pembersih Cache - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Paket yang dihapus</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>Jaga :</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="ie" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Vacuar li cache de Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Desinstallat paccages</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>Retener:</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation>Un númere de old versiones a retener</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Refriscar</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>Installat paccages</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>Vacuar</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>Vacuar %1</translation>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="is" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Skyndiminni hreinsun - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Fjarlægðir pakkar</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>Halda :</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation>Fjöldi af gömlum útgáfum til geymslu</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Hressa við</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>Uppsettir pakkar</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>Hreinsa</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>Hreinsa %1</translation>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="is_IS" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="it_IT" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -4,7 +4,7 @@
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation> - Octopi</translation>
<translation> - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="ja_JP" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -4,7 +4,7 @@
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation> - Octopi</translation>
<translation> - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="ko_KR" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation> - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation> </translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation> :</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation> </translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation> </translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation> </translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation></translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>%1 </translation>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="lv" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Kešatmiņas tīrītājs - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Atinstalētās pakas</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>Saglabāt:</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation>Saglabājamo versiju skaits</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Atjaunot</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>Instalētās pakas</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>Tīrīt</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>Tīrīt %1</translation>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="oc" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Paquets desinstallats</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Refrescar</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>Paquets desinstallats</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="pl_PL" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation type="unfinished"/>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation type="unfinished"/>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation type="unfinished"/>
</message>
</context>
</TS>

View File

@@ -4,12 +4,12 @@
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Limpar Cache - Octopi</translation>
<translation>Limpeza de Cache - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Pacotes não instalados</translation>
<translation>Pacotes desinstalados</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
@@ -27,7 +27,7 @@
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Actualizar</translation>
<translation>Atualizar</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="ru_RU" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Очистка кэша - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Удалённые пакеты</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>Оставить:</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation>Сколько старых версий оставить</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Перечитать</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>Установленные пакеты</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>Очистить</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>Очистить %1</translation>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="sr" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Čistač Keša - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Uklonjeni paketi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>Zadržati:</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation>Broj starih verzija za čuvanje</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Osveži</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>Instalirani paketi</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>Očisti</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>Čisto 1%</translation>
</message>
</context>
</TS>

View File

@@ -0,0 +1,51 @@
<?xml version="1.0" ?><!DOCTYPE TS><TS language="sv_SE" version="2.0">
<context>
<name>CacheCleaner</name>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
<source>Cache Cleaner - Octopi</source>
<translation>Cachestädare - Octopi</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
<source>Uninstalled packages</source>
<translation>Avinstallerade paket</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
<source>Keep :</source>
<translation>Behåll :</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
<source>Number of old versions to keep</source>
<translation>Antal gamla versioner att behålla</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
<source>Refresh</source>
<translation>Uppdatera</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
<source>Installed packages</source>
<translation>Installerade paket</translation>
</message>
</context>
<context>
<name>PackageGroupModel</name>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
<source>Clean</source>
<translation>Städa</translation>
</message>
<message>
<location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
<source>Clean %1</source>
<translation>Städa %1</translation>
</message>
</context>
</TS>

Some files were not shown because too many files have changed in this diff Show More