- Bugfix in refresh

Show current version of the packages on the System Upgrade window

.gitignore

@@ -0,0 +1,33 @@
+*.user
+.qmake.stash
+.qtc_clangd/**
+Makefile
+bin/**
+build/**
+build_dir/**
+helper/*.o
+helper/.qtc_clangd/**
+helper/moc*.*
+helper/octphelper
+cachecleaner/bin/**
+cachecleaner/build/**
+cachecleaner/.qtc_clangd/**
+notifier/bin/**
+notifier/build/**
+notifier/.qtc_clangd/**
+notifier/.qtc/**
+notifier/.cmake/**
+notifier/CMakeCache*
+notifier/CMakeFiles*
+notifier/qtcsettings.cmake
+octopi.pro.user
+qrc_resources.cpp
+repoeditor/.qtc_clangd/**
+repoeditor/bin/**
+repoeditor/build/**
+sudo/*.o
+sudo/moc*.*
+sudo/octopi-sudo
+sudo/qrc*.cpp
+sudo/ui_pass*.h
+sudo/.qtc_clangd

.tx/config

@@ -0,0 +1,11 @@
+[main]
+host = https://www.transifex.com
+
+[o:arnt:p:octopi:r:octopi]
+file_filter            = resources/translations/octopi_<lang>.ts
+source_file            = resources/translations/octopi_en.ts
+source_lang            = en
+type                   = QT
+replace_edited_strings = false
+keep_translations      = false
+

CHANGELOG

@@ -1,4 +1,531 @@
-0.3.2
+0.19 (dev)
+  BugFix: Pressing F11 to maximize bottom panel crashed Octopi if Info tab was selected.
+  BugFix: Octopi crashed after using AUR/KCP tool and clicking on a package anchor 
+    in Output tab.
+  BugFix: Optional deps dialog had a column header named "3" instead of "Repository".
+  BugFix: Some outdated AUR pkgs were not showing on notifier (thanks to urbenlegend).
+  BugFix: There was a method called more than once every time distro news was checked.
+  Add the option to make the whole interface text less condensed.
+  Add the option to show/hide "Repository" and "Download Size" columns in package list.
+  Add Repository field in Info tab.
+  Make "Search for outdated AUR packages" a notifier only option.
+  Enable Check updates and System upgrade tool buttons in AUR mode.
+  Show current version of the packages on Notifier's System Upgrade dialog 
+    (thanks to valchx's code).
+  Added chinese description for the application name in desktop file.
+  Updated translations.
+
+0.18.1 (2025-09-29)
+  BugFix: French translation was not working properly (thanks to roxfr).
+  BugFix: Yay searches with version 12.5.2 crashed Octopi (thanks to nije-to-sve).
+  BugFix: Search for BASH also in "/bin".
+  BugFix: Force use of BASH shell was not working (thanks to UnsaltedScholar).
+  BugFix: List of outdated KCP packages was not working in KaOS.
+  BugFix: Under some conditions Octopi could crash due to shared memory access failures.
+  Updated translations.
+
+0.18.0 (2025-09-20)
+  BugFix: The act of moving the mouse over the package list was triggering many
+    "pacman -Si" executions (thanks to RAZUMNO).
+  BugFix: Notifier did not fetch updates for the first time when using "once a day".
+  BugFix: qt-sudo now respects user locale settings (thanks to D10RUS).
+  BugFix: Use better way to detect if user is running the tools from the right place.
+  BugFix: Select Help tab when Octopi runs for the first time.
+  BugFix: Make Actions tab visible when a package is selected for insertion/removal.
+  BugFix: Use system theme folder icon in Files tab.
+  BugFix: Package list refresh was not running after a group install/removal.
+  BugFix: ILoveCandy option was not working 100% in parser.
+  Search option selected by the user is saved on close.
+  Added support for garuda-update command when running in Garuda Linux.
+  Added support for a user specified backup shell script that needs to be placed at 
+    "/usr/lib/octopi/pre-system-upgrade.sh" and executes before the system upgrades.
+  Added support for pacman.conf's IgnorePkg option through "Add to Ignored" and 
+    "Remove from Ignored" actions from the context menu in the package list.
+  Added View/Ignored menu option.
+  Added support for Plus and Minus keys to add and remove packages from the system.
+  Added "Get Latest distro news" menu item to the News tab context menu.
+  Added Apply and Cancel buttons also in the Actions tab.
+  Added "Enable package tooltips" option, so users can disable the feature when needed.
+  Added "Force use of BASH shell" option to ensure compatibility when the user 
+    uses another SHELL.
+  Added Tools/pacman-key option to refresh pacman gpg keys.
+  Modernization of Options dialog.
+  Updated translations.
+
+0.17.0 (2025-02-18)
+  BugFix: Code for EndeavourOS news was incomplete (thanks to LegitGreenBoi).
+  BugFix: Help msg for newer packages was wrong because they're not installed.
+  Prefer Bash shell (/usr/bin/bash) when executing package commands.
+  Added "--editmenu" checkbox on Options dialog if you are using Yay tool.
+  Added option to always use the terminal when executing pacman actions.
+  Play a bell sound when the Terminal tab is asking for the user password.
+  Improvement: Let user choose which domain is pinged when checking for internet access 
+    (if ping.archlinux.org is down).
+  Improvement: Show a "Collecting transaction data..." msg before presenting the transaction 
+    dialog, as it can be quite slow on some systems (thanks to Valdir).  
+  Updated translations.
+
+0.16.2 (2024-06-17)
+  BugFix: Increased width of Terminal tab labels on Options dialog.
+  BugFix: Removed a debug msg when octopi was not being executed with "-d".
+  Updated translations.
+
+0.16.1 (2024-06-09)
+  BugFix: Updated some LANG environment variables to C.UTF-8.
+  BugFix: Info/Files tabs were always empty if they were selected at octopi's start.
+  BugFix: Do not install notifier's desktop file in /etc/xdg/autostart.
+  BugFix: Could not remove packages when internet connection was down (thanks to Theluga).
+  Added shortcut key "Ctrl+Shift+U" to upgrade outdated AUR packages.
+  Arrow keys navegation refresh Info and Files tabs again.
+  Updated translations.
+  
+0.16.0 (2024-05-19)
+  BugFix: '--noeditmenu' is deprecated. Use '--editmenu=false' instead (thanks to rbaruccojr).
+  BugFix: Fixed silent error when pacman's database is locked (thanks to  SloppyPuppy).
+  BugFix: Files tab expand all items by default.
+  BugFix: Updated translations.
+  Now using the unified qt-sudo project (https://github.com/aarnt/qt-sudo) for privilege escalation.
+  Default to Qt6 lib build (including qtermwidget6)
+ 
+0.15.0 (2023-09-10)
+  BugFix: Invalidate Info/Files tabs when user is navigating packages using the keyboard.
+  BugFix: Better handle dependencies while staging packages for deletion.
+  BugFix: First yay-bin download now works again.
+  BugFix: Polished navigation on Info tab dependencies
+  BugFix: AUR passwords that contained a "+" char failed to login at aur.archlinux.org.
+  BugFix: When using the pacman backend, call "pacman -Qm" to fetch ALL foreign packages.
+  BugFix: Change install reason did not work with pacman backend.
+  Made the code Qt5/Qt6 compatible.
+  Using "pacman -Fl" to view contents of non installed packages (thanks to Zesko).
+  Added a Terminal tab to options dialog to config its colors and fonts.
+  Octopi-sudo code was synced to match project "lxqt-sudo" version 1.3.0.
+
+0.14.0 (2022-10-05)
+  Added --overwrite="*" checkbox in AUR tab (Tools/Options) when using yay.
+  Octopi-sudo code was synced to match project "lxqt-sudo" version 1.1.0.
+  BugFix: Package search did not work correctly when query string contained a "+" sign.
+  BugFix: Info/Files tab refresh was duplicated.
+  BugFix: Disable (another try) Info/Files tab refresh while typing in Filter/Search 
+    line edit.
+
+0.13.0 (2022-03-30)
+  BugFix: editFile() caused a crash while in Mate desktop. Both "Open PKGBUILD" 
+    and "Show PKGBUILD diff" options were affected.
+  BugFix: removed stylesheet from treeviews. It makes dark themes look better
+    (thanks to buckmelanoma).
+  BugFix: Pressing ENTER over an installed AUR pkg no longer sends it to the 
+    install action treeview. 
+  BugFix: Made Octopi compatible with aurweb 6.x version (view PKGBUILD,
+    diff PKGBUILD, vote, unvote and list voted AUR).
+  Added "Outdated" filter/option on menu "View".
+  Added a "-checkupdates" parameter to Notifier, so users can update the status
+    of an already running Octopi Notifier.
+  Added option to update selected outdated AUR pkgs directly from the main list.
+ 
+0.12.0 (2021-11-06)
+  Added support for pacman 6.0 (thanks to class101)
+  Added support for Paru AUR tool.
+  Added support for opendoas tool (default).
+  Added support for Archcraft OS.
+  Added support for Garuda Linux distro.
+  Added support for Obarun Linux distro.
+  Actions tab shows a counter feedback for inserts (with a plus signal) and 
+    removals (with a minus signal) and does not steal focus anymore.
+  Octopi-sudo code was synced to match project "lxqt-sudo" version 1.0.0.
+  BugFix: Initial database searches are executed after main interface is shown. 
+    This improves UI feedback on older cpus.
+  BugFix: If there was only 1 result in AUR search, the pkg could not enter 
+    the transaction with the right name.
+  BugFix: IgnorePkg pkgs are shown as outdated when using ALPM backend.
+  BugFix: If user went from AUR to normal search with a not found pkg the statusbar
+    counters would become invisible.
+  BugFix: If options dialog was called while both notifier and octopi were running,
+    Updates tab was not shown.
+
+0.11.0 (2021-01-11)
+  Added support for CMake build system (thanks to Tereius).
+  Added support to build multiple foreign packages at once (they are first copied 
+	to the Actions' tree view just like official packages).
+  Added "Open PKGBUILD" option to open the AUR PKGBUILD file in a text editor.
+  Added "Show PKGBUILD diff" option to show the differences between latest and previous
+	PKGBUILD files of the selected AUR package in a text editor.
+  Added "Install Date" at Info tab.
+  Added "Licenses", "Maintainer", "Depends On", "Make Deps", "Last Modified" and "Out-of-date" 
+	fields at Info tab while in AUR mode.
+  Added option to display "Licenses", "Installed Size", "Build Date", "Install Date" and
+	"Install Reason" columns in the package list.
+  Added option to "Change Install Reason" of selected packages (Explicitly <-> As Dependency).
+  Added a faster refresh package list code after checking for updates.
+  Added "Build directory" option in AUR tab on options dialog, so users can change where
+	makepkg builds the source code.
+  Added support for '^' and '$' chars in AUR search
+  Added "Open news in a browser" option on right clicking the News tab.
+  Optional package dependencies are now installed with "--asdeps" parameter.
+  Octopi-sudo code was synced to match project "lxqt-sudo" version 0.16.0.
+  Updated PKGBUILD file following MatMoul's suggestion.
+  Removed unused speedup service.
+  Prevent users from running Octopi, Notifier and Cache Cleaner outside "/usr/bin" dir.
+  BugFix: Disable Info/Files tab refresh while typing in filter/search line edit.
+  BugFix: unset TMPDIR environment variable on every Octo tool startup 
+	(to avoid "octopi-helper[aborted]: Couldn't attach to memory" errors).
+  BugFix: "total download size" showed the value 0 in Notifier if the database was not synched.
+  BugFix: Pressing ESC in repoeditor could ask if you wanted to save your changes even
+	if there were no changes made.
+  BugFix: Running Notifier within a DE session could lead to a "Suspicious execution method" error.
+  BugFix: If you tried to execute octopi after upgrading your system with notifier you got a
+	notifier crash and an octopi freeze (thanks to linuxer for pointing that out).
+  BugFix: Prevent icon changes in notifier when there were transaction errors.
+  BugFix: The list of targets to install were not showing ok in the transaction dialog.
+  BugFix: Restored support for command line parameters like "-sysupgrade-noconfirm" and "-style".
+  BugFix: Updated "-help" output text.
+  BugFix: Tab navigation improvements.
+  BugFix: Statusbar showed a number of packages when the list was empty (the previous value).
+  BugFix: Clicking on printed outdated packages in Output tab did not send to corresponding 
+	package in the main list after a 'Check updates'.
+  BugFix: WM detection now uses "ps -aux".
+
+0.10.0 (2020-07-19)
+  Added a built-in default priviledge escalation tool: "octopi-sudo" as a slightly modified version 
+	of "lxqt-sudo" project (version 0.15.0). It's the only escalation tool supported!
+  Added option to vote/unvote for AUR packages using aur.archlinux.org login.
+  Added "pikaur" AUR tool support (thanks to ewilly).
+  Added "yay" AUR tool support.
+  Added option "--devel" in AUR tab to check for newer versions of dev packages.
+  Added option to download a temporary yay-bin to enable AUR.
+  Updated some UI icons and added an specific one for foreign non installed pkg.
+  Dropped support for external terminal applications. QTermWidget is mandatory now!
+  Print ".pacnew" file list summary after upgrade (if any).
+  Added Lumina desktop support.
+  RepoEditor now saves window size and position.
+  Added "copy" command to octopi's embedded terminal context menu.
+  Added option to enable/disable confirmation dialog in system upgrade.
+  Added option to enable/disable internet checking.
+  Renamed Transaction tab to Actions tab.
+  Added left click support on package icon in package list to launch context menu.
+  Added option to never check for package updates in Notifier.
+  Added tooltip "Upgrading..." while Notifier is upgrading the system.
+  Added "Info" option in package list context menu.
+  Added ArcoLinux, Artix Linux, CondresOS and EndeavourOS distro support.
+  Added support for sudo (and NOPASSWD) executing thru new octopi-helper subproject.
+  Added option to exit Octopi while a transaction is already running.
+  Added support for GNOME file manager/editor.
+  Added option for changing use of alternating row colors in package list.
+  Added a redesigned AUR tab in Options dialog.
+  Added option to change terminal's color scheme, font family and font size through ~/.config/octopi/octopi.conf.
+  Maximization of properties pane now hides tab bar.
+  BugFix: Many clazy/manual code enhancements merged from luis-pereira (from LXQt organization).
+  BugFix: AUR upgrades in notifier were not setting m_commandExecuting flag.
+  BugFix: Make notifier code consistent with AUR upgrades.
+  BugFix: Replaced 'Sync database' command text to 'Check updates'.
+  BugFix: Always do a "pacman -Syu" in System Upgrade.
+  BugFix: Notifier now uses "checkupdates" instead "pacman -Sy[y]". This means Octopi no longer can lead 
+	the OS to a "partial updates" state and works gracefully with other package tools.
+  BugFix: Don't let user exits RepoEditor without answerig if he wants to save changes.
+  BugFix: Sometimes non-outdated AUR packages did not get refreshed.
+  BugFix: Now Actions tab is disable while in AUR mode.
+  BugFix: Make "Open terminal here" option work with qtermwidget.
+  BugFix: Added support for symbolic lynks in "open file".
+  BugFix: Pkg build date obeys Locale datetime format.
+  BugFix: SysInfo no longer pushes the collected logs to a remote paste service. It saves them locally.
+  BugFix: "exists in filesystem" messages during transactions are shown again.
+  BugFix: MultiselectionDialog did not resize pkg description automatically.
+  BugFix: Some packages were not displaying Optional Deps at Info tab.
+  BugFix: Huge delay when scrolling thru large package list.
+  BugFix: Speed improvements in package list building.
+  BugFix: OptionsDialog was not saving AUR settings if tab changed before clicking OK.
+  BugFix: Changed Manjaro news url.
+  BugFix: Notifier checked for available internet connection too early with an error dialog box.
+  BugFix: Changed command string to Reinstall/Update when package is already installed or outdated.
+  BugFix: Clear filter line edit when navigating thru package anchors at Info tab.
+  BugFix: Info and Files tabs were not showing any info automaticaly when switching between 
+	foreign tool/pacman lists.
+  BugFix: Enable a more complete UI lockdown during transactions.
+  BugFix: Enable "Find a file" context menu option on a non installed pkg.
+
+0.9.0 (2018-06-08)
+  Parser changes: added counter for processed packages.  
+  Group pane now spans all window's height.
+  SysInfo now uses ptpb site and does not block interface.
+  Added Trizen (AUR tool) support.
+  Added Terminal tab if user compiles project with libqtermwidget5 support.
+  Added Terminal dialog in Notifier (AUR update) if user compiles project with 
+	libqtermwidget5 support.
+  Added an Options dialog to Octopi and Notifier.
+  Added button after progressbar to stop current running transaction.
+  Added configurable "--noconfirm" and "--noedit" options to pacaur and "--noconfirm" to yaourt.
+  Added "Search/Use Instant Search" toggle.
+  Added slovenian translation (thanks to the translation crew).
+  Added support fo drag pacman packages to Octopi's mainwindow so they can be installed.
+  Added "Install Reason" field at Info tab.
+  Added support for ALPM utils lib (thanks to guinux, from Pamac project). So, now it's possible to 
+	show "Download Size" in package list.
+  Added link support in all Info tab package lists.
+  Added option to upgrade outdated foreign packages from Octopi Notifier.
+  Added Hindi translation (thanks to Panwar108).
+  Name of AUR package in Info tab act as link to its site at https://aur.archlinux.org.
+  Search line edit is always focused when the program starts.
+  Prevent user to install partial upgrades in his system (ex: only some of the outdated packages).
+  Do NOT clear search string when switching between AUR/pacman.
+  BugFix: If threre are updated News after a synchronization, let's goto the News Tab.
+  BugFix: Remove only Octopi tools related temporary files (qtsingleapp*).
+  BugFix: Do not let program display an avalanche of internet related errors.
+  BugFix: Exec internet tests before some commands in Octopi and Notifier.
+  BugFix: Parser was not outputing repository errors when syncinc.
+  BugFix: repoeditor now runs as normal user and asks for root password on save.
+  BugFix: If Notifier hid Octopi and was closed, Octopi's window would stay hidden.
+  BugFix: Notifier's about dialog was never screen centered.
+  BugFix: When no AUR helper exists, the group of packages panel stayed disabled.
+  BugFix: Cache Cleaner now saves its window geometry.
+  BugFix: Infinite wait cursor in Cache Cleaner when user press Enter for more than two
+	seconds in the spin boxes.
+  BugFix: Some pkg download/installed sizes were not showing properly at Info tab.
+  BugFix: If we find an outdated AUR pkg in the official pkg list, we remove it.
+  BugFix: Install local packages did not work with space separated paths 
+	(thanks to voanhcuoc for pointing it out).
+  BugFix: About and System Upgrade dialogs could be opened twice in notifier.
+  BugFix: Max time in minutes for notification interval was not honoring > 1380.
+  BugFix: Optional dependencies dialog can now be resized and new value is 
+	persisted on disk.
+  BugFix: Using the alpm algorithm for package version comparison. Previous code 
+	was reporting false newer packages.
+  BugFix: System upgrade button was not disabled while synching packages in notifier.
+  BugFix: searchlineedit font fix.
+  BugFix: 'yaourt' and 'pacaur' no longer honor "-a" option when querying outdated 
+	foreign packages.
+  BugFix: System upgrade shortcut changed to "ctrl+P" as "ctrl+U" is used to cut text in 
+	QLineEdit widgets.
+  BugFix: When user selected another search option, line edit was not being cleared.
+  BugFix: Disable alien icon while in transaction.
+  BugFix: Do not ask twice for password if a pacman lck file exists.
+
+0.8.1 (2016-03-27)
+  BugFix: Updated CHAKRA RSS site (thanks to s8321414).
+  BugFix: Distro news now works with https KaOS site.
+  BugFix: Files tab was not refreshing when enabling KCP mode in KaOS.
+  BugFix: Do not permit two or more octopi instances if one is in root mode.
+  BugFix: When there's a pkg change outside Octopi, we trigger a flag to refresh the lists.
+  BugFix: When you were searching for a pkg and the Files tab was selected, focus got lost.
+  BugFix: Package dependencies with >, <, =, >= and <= signals were not clickable in Info tab.
+  BugFix: When user commits a transaction, commit and cancel buttons must get disabled.
+  Package list now also preserves sort column and sort order while in AUR/KCP/CCR mode.
+  Make Octopi more keyboard friendly.
+  Pressing <ENTER>, <RETURN> and <DELETE> keys on package list triggers package actions.
+  Stop using 'notify-send' in octopi-notifier: the era of annoying notifiers is over.
+  Major refactoring: Decoupling of Pacman executor and parser code from the UI as well as 
+	SearchBar slots for QTextBrowser objects.
+  Added URL information to yaourt/pacaur remote pkgs at Info tab.
+  Added <F2> shortcut to focus package list.
+  Added an output dialog to notifier, so users can do a system upgrade without a terminal.
+  Added an entry for Mirror-check in Tools menu.
+  Added support for Simplified Chinese (zh_CN).
+  Added support for lxqt-sudo tool (thanks to Manjaro team).
+  Added "pkgfile -u" (if available) in sync db transaction.
+
+0.8.0 (2015-11-08)
+  This is a Qt5 only version (with the exception of 'octopi-notifier').
+  BugFix: Speed optimizations in startup code (AUR outdated list).
+  BugFix: Octopi now honors the $SHELL variable (thanks to LAC1213).
+  BugFix: If user refused to remove pacman's lock file, commands
+	should be canceled!
+  BugFix: Sync Interval dialog was not showing strings in some languages.
+  BugFix: Package counters were not zeroing when searches found no results.
+  BugFix: In some very specific situations Info tab did not refresh info of 
+	selected package.
+  BugFix: If user tried to sync db with kdesu and clicked "ESC", some garbage  
+	went to Output tab.
+  BugFix: When user closed searchbar inside a QTextBrowser, cursor position was 
+	reseted.
+  BugFix: Transaction dialog can now be resized and new value is persisted on disk.
+  BugFix: No columns warning while executing actions inside Octopi (thanks to flying-sheep).
+  BugFix: Cinnamon DE detection fix (thanks to jdelmas).
+  BugFix: Added option to search files with "\+" (escaping the  plus sign). This would find things such 
+	as C++ => "c\+\+" (thanks to maxis11).
+  Added support to "kcp --information" at Info tab.
+  Now Files tab shows a progressbar while building the list of files.
+  Yellow notifier icon tooltip now displays Foreign repo tool name.  
+  When outdated packages are printed at Output tab, you can see their 
+	information just hovering the mouse over them.
+  Added Parabola GNU/Linux-libre support (thanks to coadde).
+  Added galician translation (thanks to Ismael Ordóñez).
+  At Info tab, packages in "depends On" field are shown as clickable anchors.
+  Information tab now supports "ctrl+F" searching.
+  Help/About dialog now shows Pacman information.
+  StatusBar msg got updated with number of selected packages more visible.  
+
+0.7.0 (2015-04-27)
+  Major speed fix: Faster pkg list building.
+  Reverted to showing ALL packages at startup.
+  Added a systemd service to speed up the very first octopi startup time.
+  Added "Copy path to clipboard" context menu option in file list treeview.
+  Now pacman.conf's "IgnoreGroup" option is honored.
+  Disabled "View/Repository/[kcp | aur]" menu item.
+  Toolbar now shows AUR tool button instead of a fake pacman group.
+  Reenabled Pacaur support.
+  Now Package treeview columns get their widths saved.
+  Remove "Yes" button from transaction dialog, everytime 'pacman' 
+	is one of the target packages.
+  SearchBar now reacts to an ENTER or RETURN key press to search for 
+	next found item.
+  Added a notifier setup dialog to set "sync database" interval.
+  Generate a system info report if "gist" tool is available.
+  Added a "-d" switch to octopi and notifier to show some debug info.
+  BugFix: No more horizontal scrollbar in AUR mode.
+  BugFix: When a transaction is available, disable sync pkg and system 
+	upgrade, as well as mirror-check and AUR mode.
+  BugFix: Repository column would get wider after switching from AUR 
+	mode.
+  BugFix: Filter connect chain bug decreased filter's performance over time.
+  BugFix: Search by name was not being used after reverting from AUR search.
+  BugFix: F3 and Shift+F3 keys at SearchBar were not working.
+  BugFix: Sometimes downloaded and installed size information were in KiB, 
+	instead of MiB.
+  BugFix: If user had no gksu/kdesu/root when clicking "clean" button in 
+	cachecleaner, cursor would remain waiting (thanks to imperator-).
+
+0.6.0 (2015-02-27)
+  BugFix: Pkg list was being refreshed twice sometimes.
+  BugFix: Removed some buggy strings from Output tab while in KF5.
+  BugFix: ArrowUp/Down, PageUp/Down and Home/End keys now refresh Package Info tab.
+  BugFix: Open file was not working in KF5.
+  BugFix: Filter by repo was not working with Qt 5.4 libs (thanks to sl1pkn07).
+  BugFix: Chakra CCR for installing pkgs was not being called.
+  BugFix: Notifier would not test for internet connection.
+  BugFix: Repoeditor uses user defined translation (if available) while launched from Octopi.
+  BugFix: Honor plural forms in some languages (thanks to SafaAlfulaij).
+  BugFix: When only notifier is installed, we don't refer Octopi in context menu nor  
+	system upgrade dialog.
+  BugFix: Removed another buggy string while in plasma5.
+  BugFix: Opens install local pkg when you associate octopi to pacman files.
+  BugFix: PacmanHelper is a project related to Octopi-notifier (fix at PKGBUILD).
+  Always reset to "View ALL/ALL repos" when pkg group is changed.
+  Added more safety checks before running octopi-notifier.
+  Now notifier does not close Octopi.
+  Disabled Pacaur support.
+  Now PKGBUILD defaults to Qt5 builds.
+  At startup only installed packages are shown (if distro is not KaOS).
+  Added cachecleaner, a frontend to 'paccache' (thanks to Michaël Lhomme).
+  Added new KDE detection logic (thanks to Kirek).
+  KaOS only: added support for newer versions of Cellix's awesome KCP tool (much faster).
+  KaOS only: do a "kcp -u" sync while in "sync database" and notifier.
+  Refactorings in SearchLineEdit.
+  BugFixes in RepoEditor translation support (repoeditor is now in Transifex too).
+
+0.5.0 (2014-11-08)
+  BugFix: RepoEditor would not compile with Qt5 lib (thanks to Philm).
+  BugFix: Suppress GConf error strings in output.
+  BugFix: mate-terminal is returning code 255 even when execution of 
+	transaction was ok (thanks to ringo32).
+  BugFix: Keep groups panel hidden (if it were before) after pressing 
+	F12 or F10.
+  BugFix: Merged offa's pull request that fixed a bunch of things.
+  BugFix: RepoEditor didn't take into account repo SigLevels while 
+	saving .conf files.
+  Added Qt version in About dialog boxes (also in notifier).
+  Changed repoeditor icon to octopi_green.
+  Show/hide groups panel config is now persisted.
+  Now notifier syncs db once a day and save last synced time.
+  Changed package size to MiB when it was > 1024 KiB.
+  Added option "SyncDbHour" so notifier checks only when that specific hour ticks, 
+	again once a day.
+  Added "sync db" menu option to notifier.
+  Added support for hiding/showing Octopi window in the new KF5 notifier code.
+  Added support for Ctrl+F in Output tab.
+  Added support for the user to choose his terminal by editing 
+	~/.config/octopi/octopi.conf.
+  Added QtQuick code for user change terminal (only if Qt >= 5.3).
+  Added support for KStatusNotifier while in KDE (thanks to brcha).
+  Updated translations.
+
+0.4.2 (2014-07-26)
+  BugFix: when searching AUR pkgs, given search string was not being matched 
+	by package descriptions.
+  BugFix: Sometimes got a gconf bug string at sync db.
+  Updated a bunch of translations.
+  Added support for the new kcp tool (Go version).
+
+0.4.1 (2014-07-12)
+  Added basque translation (thanks to tarteka).
+  Added es_AR translation (thanks to javier).
+  Added japanese translation (thanks to UTUMI Hirosi - utuhiro78).
+  Some coding refactorings regarding Yaourt/AUR as well as utils namespace.
+  BugFix: Tools menu was not being refreshed after a package
+	removal/installation.
+  BugFix: Ctrl and Shift key pkg actions not behaving right in Qt5 
+	builds.
+  BugFix: When clicking a pkg on the outdated list, it could scroll 
+	to a wrong pkg info.
+  BugFix: Adapted ArchBang changes.
+  BugFix: Removed unused Ctrl+N help text.
+  BugFix: Some changes in LXQt support.
+  BugFix: Download and installed size info at Info tab.
+  BugFix: The 'Enter' key (numeric keyboard) is now supported.
+  BugFix: At start when there is no pacman db, octopi hangs (thanks to anex).
+  BugFix: After a pkg list rebuild the Files and Info cache were not 
+	being emptied.
+  Now downgrading operations appears in orange in Output tab.
+  Small fixes in packagemodel/package code (thanks to tbinkau).
+  Ctrl+C over an item in Files tab copies it's full path to Clipboard.
+  Reworked code to count installed packages (based on filters).
+  Leave some actions disabled before building pkg list and mirror-checking.
+  Added 'installed size' information in package tooltips.
+  Added Search by file feature (pacman -Qo).
+  Added a string validator in the search edit widget.
+
+0.4.0 (2014-05-24)
+  Huge refactorings in model/view that brings consistent memory and 
+	speed improvements - a single model and a central data storage (thanks to 
+	Thomas Binkau - tbinkau).
+  BugFix: The transparent octopi notifier icon no longer shows a white bar in the 
+	eyes (thanks to Ankde Boersma) .
+  BugFix: Fixed a jump bug when key-navigating in pkg list with Qt5 octopi.
+  BugFix: When a pkg is outdated, show all available information.
+  BugFix: Show warning if user do not have kdesu/gksu in sysupgrade/install local pkgs.
+  BugFix: System upgrade can not be available while in yaourt mode.
+  BugFix: Switching faster to yaourt mode if text field is empty.
+  BugFix: Ctrl+A is available in the package list panel.
+  BugFix: Now Shift+F3 and F3 search keys (and also Esc) work outside 
+	SearchLineEdit widget.
+  BugFix: fixed freeze for install orphaned/yaourt package (thanks to 
+	tbinkau).
+  BugFix: fixed notify-send code in octopi-notifier (thanks to vedgy).
+  BugFix: Files tab presented some nasty results sometimes and even a GPF when it
+	found symlinks to directories.
+  BugFix: running as root was broken in KDE.
+  BugFix: The preventing code for always refresh the pkg list was flawed.
+  BugFix: hasInternetConnection code fixed to improve mirror-check speed.
+  BugFix: Fixed CCR (Chakra) package installation/removal (thanks to dmnmsc).
+  BugFix: Disable group widget while searching for AUR packages.
+  Switched to "pacman -Syy" command when synching. It's safer.
+  Added support for Pacaur tool.
+  Added support to kcp in KaOS (thanks to Cellix).
+  Added support to LXQt DE.
+  Added support to ArchBSD news (thanks to bkc_).
+  Added support to Netrunner news.
+  Added support to mooOS distro (thanks to pdq).
+  Added support to Antergos distro (thanks to Yoyo).
+  Added popularity column (number of votes) in AUR/CCR mode (thanks to 
+	tbinkau).
+  Added more filter options in View menu.
+  Added parameter "sysupgrade-noconfirm" so Octopi can jump automatically 
+	to distro upgrade (if any new packages available) without prompt for 
+	confirmation. Also added a "Yes" button to the sysupgrade 
+	confirmation dialog at octopi-notifier (thanks to wget).
+  Merged Oktopi's code for using KDE icon theme, tools menu and CCR support 
+	(thanks to Giuseppe Calà - gcala).
+  Changed sorting of the first column to also include the name column as second
+        sort criteria (thanks to tbinkau).
+  Added pacman log viewer and repoeditor support in tools menu (thanks to gcala).
+  Added asturian language in Qt5 builds (thanks to Llumex03).
+  Patched repoeditor to run just one instance at a time.
+  The filelist search now searches directories too.
+  Refactorings here and there to make it more Chakra friendly.
+  Updated README file.
+  Updated some icons to unclutter the UI (thanks to Anke Boersma).
+  Refactoring in some code to not generate translatable strings.
+  Fixed getBuildDate code to always convert dates to english format.
+  Updated some translations.
+
+0.3.2 (2014-02-14)
   Cleaned unused code.
   Added icon for mirror-check while in KaOS.
   Does a mirror-check at startup while in KaOS.
@@ -13,7 +540,7 @@
   BugFix: When the user had no yaourt in the system, there were a zombie 
 	octopi process 'left running'.
 
-0.3.1
+0.3.1 (2014-01-14)
   Added support for Qt5.
   Added chinese (Taiwan), malay, slovak and ukrainian translations.
   Added support to KaOS, a lean KDE centric Linux distro.
@@ -24,7 +551,7 @@
 	first searches into transaction queue for them.
   BugFix: Prevent header resizing in File and Transaction tabs.
 
-0.3
+0.3.0 (2013-11-03) 
   Code cleanings.
   BugFix: No need to refresh package list after a cache clean.
   BugFix: Konsole was not working with yaourt package installation.
@@ -71,7 +598,7 @@
   Added an About Dialog to Octopi Notifier.
   Updated translations.
 
-0.2
+0.2.0 (2013-08-24)
   Splitted the project in "octopi" and "octopi-notifier".
   Yaourt no longer runs with root permissions.
   Added support for package multi selection in Yaourt mode.
@@ -92,23 +619,23 @@
   IgnorePkg option is now used to build outdated package list.
   BugFix: Empty pkg descriptions are now shown as empty.
 
-0.1.9.1
+0.1.9.1 (2013-07-14)
   Important bugfixes to deal with multithreaded code.
   Added a "globals.h/.cpp" file to group QFutureWatcher globals.
   Updated style changing code in main.cpp.
   BugFix: when user cancelled a sysupgrade transaction inside a 
 terminal, the package actions remained disabled.
 
-0.1.9
+0.1.9 (2013-07-09)
   Added yaourt support.
   Updated most of the translations.
 
-0.1.8
+0.1.8 (2013-06-16)
   Added czech translation.
   Added support to ArchBang Linux.
   Added a systemtray icon notifier feature using DBus technology.
 
-0.1.7.3
+0.1.7.3 (2013-05-26)
   Added a TRANSLATIONS file.
   Added danish translation.
   Added indonesian translation.
@@ -118,14 +645,14 @@ terminal, the package actions remained disabled.
   Bugfix: sysupgrade must refresh packagelist after syncdatabase.
   Bugfix: if sysupgrade uses SyncFirst, makes it automatically start a second upgrade.
 
-0.1.7.2
+0.1.7.2 (2013-05-17)
   Added catalan translation.
   Bugfix: updated new binary translation files to the resources.
 
-0.1.7.1
+0.1.7.1 (2013-05-11)
   Bugfix: menu icons were not being shown while in Xfce.
 
-0.1.7
+0.1.7 (2013-05-11)
   Added "-sysupgrade" command line option.
   Added "-removecmd" command line option.
   Added lots of translations.
@@ -133,11 +660,11 @@ terminal, the package actions remained disabled.
   Added an About dialog.
   Changed the old About tab to Usage tab.
 
-0.1.6.1
+0.1.6.1 (2013-04-25)
   Added pt_BR translation.
   Added "Open root terminal" option in File menu.
 
-0.1.6
+0.1.6 (2013-04-12)
   Added a new Transaction Dialog.
   Added a Firefox-like search inside Files, News and About tabs.
   Added support for Chakra.
@@ -145,33 +672,33 @@ terminal, the package actions remained disabled.
   Added option to execute any transaction inside a terminal.
   Changed ProgressDialog to a progressBar at the screen bottom.
   
-0.1.5
+0.1.5 (2013-04-06)
   Added option to search packages by description and name.
   Added support for pacman version 4.1.
   Transactions with conflict errors can be re-executed inside a terminal.
   Reworked Manjaro Linux theme.
 
-0.1.4.1
+0.1.4.1 (2013-03-30)
   Bugfix release
   Added total download size information in transaction dialog.
 
-0.1.4
+0.1.4 (2013-03-28)
   Added a Manjaro Linux theme.
   Changed position of filter line edit to the toolbar.
 
-0.1.3
+0.1.3 (2013-03-19)
   Added better support to Qt dark themes.
   Added context menu support inside Files tab.
-  Made URLs clickable inside output tab.
+  Made URLs clickable inside Output tab.
   Fixed the annoying Packager information display bug.
 
-0.1.2
+0.1.2 (2013-03-18)
   Tons of refactorings and bugfixes.
   Small changes in UI.
 
-0.1.1 
+0.1.1 (2013-03-17)
   Added all six tabs.
   Added support for groups of packages.
 
-0.1.0 
+0.1.0 (2013-03-11)
   Initial Proof of Concept release.

CMakeLists.txt

@@ -0,0 +1,130 @@
+cmake_minimum_required(VERSION 3.5)
+project(octopi VERSION 0.19.0 LANGUAGES CXX)
+
+set(CMAKE_CXX_STANDARD 17)
+set(CMAKE_CXX_STANDARD_REQUIRED ON)
+set(CMAKE_THREAD_PREFER_PTHREAD True)
+set(CMAKE_RUNTIME_OUTPUT_DIRECTORY "${CMAKE_CURRENT_BINARY_DIR}")
+
+option(USE_QTERMWIDGET6 "Build with qtermwidget6 instead of qtermwidget5" ON)
+
+add_subdirectory(helper)
+add_subdirectory(notifier)
+add_subdirectory(cachecleaner)
+add_subdirectory(repoeditor)
+
+if (USE_QTERMWIDGET6)
+  find_package(Qt6 REQUIRED COMPONENTS Core Core5Compat Gui Network Xml Widgets LinguistTools Multimedia)
+  find_package(qtermwidget6 REQUIRED)
+else()
+  find_package(Qt5 REQUIRED COMPONENTS Core Gui Network Xml Widgets LinguistTools Multimedia)
+  find_package(qtermwidget5 REQUIRED)
+endif()
+
+find_package(alpm_octopi_utils REQUIRED)
+
+set(CMAKE_AUTOMOC ON)
+
+file(GLOB TS_FILES LIST_DIRECTORIES false "${CMAKE_CURRENT_LIST_DIR}/resources/translations/*.ts")
+qt_add_translation(qmFiles ${TS_FILES})
+
+set(src
+    src/QtSolutions/qtsingleapplication.cpp
+    src/QtSolutions/qtlocalpeer.cpp
+    repoeditor/repoentry.cpp
+    src/aurvote.cpp
+    src/propertiestabwidget.cpp
+    src/qaesencryption.cpp
+    src/repoconf.cpp
+    src/main.cpp
+    src/mainwindow.cpp
+    src/strconstants.cpp
+    src/searchlineedit.cpp
+    src/argumentlist.cpp
+    src/settingsmanager.cpp
+    src/package.cpp
+    src/unixcommand.cpp
+    src/wmhelper.cpp
+    src/treeviewpackagesitemdelegate.cpp
+    src/mainwindow_init.cpp
+    src/mainwindow_transaction.cpp
+    src/mainwindow_events.cpp
+    src/mainwindow_help.cpp
+    src/searchbar.cpp
+    src/mainwindow_searchbar.cpp
+    src/transactiondialog.cpp
+    src/mainwindow_news.cpp
+    src/mainwindow_refresh.cpp
+    src/globals.cpp
+    src/multiselectiondialog.cpp
+    src/packagerepository.cpp
+    src/model/packagemodel.cpp
+    src/ui/octopitabinfo.cpp
+    src/utils.cpp
+    src/terminal.cpp
+    src/pacmanexec.cpp
+    src/optionsdialog.cpp
+    src/packagetreeview.cpp
+    src/termwidget.cpp
+    src/alpmbackend.cpp)
+
+set(header
+    src/QtSolutions/qtsingleapplication.h
+    src/QtSolutions/qtlocalpeer.h
+    repoeditor/repoentry.h
+    src/aurvote.h
+    src/propertiestabwidget.h
+    src/qaesencryption.h
+    src/repoconf.h
+    src/mainwindow.h
+    src/strconstants.h
+    src/searchlineedit.h
+    src/argumentlist.h
+    src/settingsmanager.h
+    src/uihelper.h
+    src/package.h
+    src/unixcommand.h
+    src/wmhelper.h
+    src/treeviewpackagesitemdelegate.h
+    src/searchbar.h
+    src/transactiondialog.h
+    src/globals.h
+    src/multiselectiondialog.h
+    src/packagerepository.h
+    src/model/packagemodel.h
+    src/ui/octopitabinfo.h
+    src/utils.h
+    src/terminal.h
+    src/pacmanexec.h
+    src/constants.h
+    src/optionsdialog.h
+    src/packagetreeview.h
+    src/termwidget.h
+    src/alpmbackend.h)
+
+set(ui ui/mainwindow.ui ui/transactiondialog.ui ui/multiselectiondialog.ui ui/optionsdialog.ui)
+
+set(qrc resources.qrc)
+
+qt_wrap_ui(src ${ui})
+qt_add_resources(src ${qrc})
+
+add_executable(octopi ${src} ${header} ${qmFiles})
+target_compile_definitions(octopi PRIVATE OCTOPI_EXTENSIONS ALPM_BACKEND QT_DEPRECATED_WARNINGS QT_USE_QSTRINGBUILDER QT_NO_CAST_FROM_ASCII QT_NO_CAST_TO_ASCII QT_NO_URL_CAST_FROM_STRING QT_NO_CAST_FROM_BYTEARRAY)
+
+if (USE_QTERMWIDGET6)
+  target_include_directories(octopi PRIVATE ${CMAKE_CURRENT_SOURCE_DIR} ${CMAKE_CURRENT_BINARY_DIR} ${Qt6Core_INCLUDE_DIRS} ${Qt6Gui_INCLUDE_DIRS} ${Qt6Network_INCLUDE_DIRS} ${Qt6Xml_INCLUDE_DIRS} ${Qt6Widgets_INCLUDE_DIRS})
+  target_link_libraries(octopi PRIVATE Qt6::Core Qt6::Gui Qt6::Network Qt6::Xml Qt6::Widgets Qt6::Multimedia qtermwidget6 alpm_octopi_utils)
+else()
+  target_include_directories(octopi PRIVATE ${CMAKE_CURRENT_SOURCE_DIR} ${CMAKE_CURRENT_BINARY_DIR} ${Qt5Core_INCLUDE_DIRS} ${Qt5Gui_INCLUDE_DIRS} ${Qt5Network_INCLUDE_DIRS} ${Qt5Xml_INCLUDE_DIRS} ${Qt5Widgets_INCLUDE_DIRS})
+  target_link_libraries(octopi PRIVATE Qt5::Core Qt5::Gui Qt5::Network Qt5::Xml Qt5::Widgets Qt5::Multimedia qtermwidget5 alpm_octopi_utils)
+endif()
+
+file(COPY "${CMAKE_CURRENT_SOURCE_DIR}/resources/images/octopi_green.png" DESTINATION "${CMAKE_CURRENT_BINARY_DIR}")
+file(RENAME "${CMAKE_CURRENT_BINARY_DIR}/octopi_green.png" "${CMAKE_CURRENT_BINARY_DIR}/octopi.png")
+install(TARGETS octopi RUNTIME DESTINATION bin LIBRARY DESTINATION lib PUBLIC_HEADER DESTINATION include)
+install(FILES "${CMAKE_CURRENT_SOURCE_DIR}/octopi.desktop" DESTINATION share/applications)
+install(FILES "${CMAKE_CURRENT_BINARY_DIR}/octopi.png" "${CMAKE_CURRENT_SOURCE_DIR}/resources/images/octopi_green.png" DESTINATION share/icons/hicolor/48x48/apps)
+install(FILES "${CMAKE_CURRENT_BINARY_DIR}/octopi.png" "${CMAKE_CURRENT_SOURCE_DIR}/resources/images/octopi_green.png"
+        "${CMAKE_CURRENT_SOURCE_DIR}/resources/images/octopi_red.png" "${CMAKE_CURRENT_SOURCE_DIR}/resources/images/octopi_yellow.png" DESTINATION share/icons/hicolor/48x48/apps)
+install(FILES "${CMAKE_CURRENT_SOURCE_DIR}/LICENSE" DESTINATION share/licenses/octopi)

INSTALL

@@ -1,19 +1,16 @@
 Installing Octopi is a pretty straightforward task. 
 
-Assuming you have updated Qt4 libs installed in your system, just run:
+Assuming you have updated Qt5 libs installed in your system, all
+you have to do is run:
 
 	makepkg -f
 
 Wait for the compilation and then install the generated package (as 
 root), using:
 
-	pacman -U [--force] <nameOfTheGeneratedOctopiPackage.tar.xz>
+        pacman -U <nameOfTheGeneratedOctopiPackage.tar.[xz|zst]>
 
-You can also install the generated package notifier, using:
-
-	pacman -U [--force] <nameOfTheGeneratedOctopiNotifierPackage.tar.xz>
-
-Octopi is located at the system utilities menu of your Desktop 
+Octopi is located on the system utilities menu of your Desktop
 Environment.
 
 

PKGBUILD

@@ -1,68 +1,53 @@
-pkgname=('octopi' 'octopi-notifier')
-pkgver=0.3.1
+_pkgname=octopi
+pkgname=octopi-git
+pkgver=0.19.0.latest
 pkgrel=1
-pkgdesc="a powerful Pacman frontend using Qt libs"
+pkgdesc="This is Octopi, a powerful Pacman frontend using Qt libs (git checkout)"
+url="https://tintaescura.com/projects/octopi/"
 arch=('i686' 'x86_64')
-url="http://octopiproject.wordpress.com"
 license=('GPL2')
-install=$pkgname.install
+depends=('alpm_octopi_utils' 'qtermwidget' 'sudo')
 makedepends=('git')
-depends=('qt4' 'xterm')
-optdepends=('kdesu: for KDE'
-            'gksu: for XFCE, Gnome, LXDE, Cinnamon'
-            'gnome-keyring: for password management'
-            'yaourt: for AUR support'
-            'octopi-notifier: for notifications'
-            'pkgfile: to view uninstalled pkg contents in ArchLinux')
-provides=('octopi')
-md5sums=()
+groups=('system')
+source=("git+https://github.com/aarnt/octopi.git")
+md5sums=('SKIP')
+
+prepare() {
+   cd "${_pkgname}"
+   cp resources/images/octopi_green.png resources/images/octopi.png
+}
+
+#pkgver() {
+#   cd "${_pkgname}"
+#   git describe --long --tags --abbrev=7 | sed 's/\([^-]*-g\)/r\1/;s/-/./g;s/^v//'
+#}
 
 build() {
-    cpucount=$(grep -c processor /proc/cpuinfo 2>/dev/null)
-    jc=$((${cpucount:-1}))
+   cd "${_pkgname}"
+   echo "Starting build..."   
+   qmake6 PREFIX=/usr QMAKE_CFLAGS="${CFLAGS}" QMAKE_CXXFLAGS="${CXXFLAGS}" QMAKE_LFLAGS="${LDFLAGS}" octopi.pro
+   make
 
-    #cd "$srcdir"  
-    msg "Starting build..."
+   _subdirs="cachecleaner helper notifier repoeditor"
 
-    cd $startdir
-    qmake-qt4 $pkgname.pro 	
-    make -j $jc
-
-    cd $startdir/notifier/pacmanhelper
-    msg "Building pacmanhelper..."
-    qmake-qt4 pacmanhelper.pro
-    make -j $jc    
-    
-    cd $startdir/notifier/octopi-notifier
-    msg "Building octopi-notifier..."
-    qmake-qt4 octopi-notifier.pro
-    make -j $jc
+   for _subdir in $_subdirs; do
+     pushd $_subdir
+     echo "Building octopi-$_subdir..."
+     qmake6 PREFIX=/usr QMAKE_CFLAGS="${CFLAGS}" QMAKE_CXXFLAGS="${CXXFLAGS}" QMAKE_LFLAGS="${LDFLAGS}" "octopi-$_subdir.pro"
+     make
+     popd
+   done  
 }
 
-package_octopi() {   
-   #Octopi main files
-   install -D -m755 $startdir/bin/$pkgname ${pkgdir}/usr/bin/$pkgname
-   install -D -m644 $startdir/$pkgname.desktop ${pkgdir}/usr/share/applications/$pkgname.desktop
-   install -D -m644 $startdir/resources/images/${pkgname}_green.png ${pkgdir}/usr/share/icons/$pkgname.png
-   install -D -m644 $startdir/resources/images/${pkgname}_green.png ${pkgdir}/usr/share/icons/gnome/32x32/apps/$pkgname.png
-   install -D -m644 $startdir/resources/images/${pkgname}_red.png ${pkgdir}/usr/share/icons/${pkgname}_red.png
-   install -D -m644 $startdir/resources/images/${pkgname}_yellow.png ${pkgdir}/usr/share/icons/${pkgname}_yellow.png
+package() {
+   cd "${_pkgname}"
+   make INSTALL_ROOT="${pkgdir}" install
 
-   #Pacmanhelper service files
-   install -D -m755 $startdir/notifier/bin/pacmanhelper ${pkgdir}/usr/lib/octopi/pacmanhelper
+   _subdirs="cachecleaner helper notifier repoeditor"
 
-   install -D -m644 $startdir/notifier/pacmanhelper/polkit/org.octopi.pacman.policy ${pkgdir}/usr/share/polkit-1/actions/org.octopi.pacman.policy
-   install -D -m644 $startdir/notifier/pacmanhelper/polkit/org.octopi.pacmanhelper.conf ${pkgdir}/etc/dbus-1/system.d/org.octopi.pacmanhelper.conf
-   install -D -m644 $startdir/notifier/pacmanhelper/polkit/org.octopi.pacmanhelper.xml ${pkgdir}/usr/share/dbus-1/interfaces/org.octopi.pacmanhelper.xml
-   install -D -m644 $startdir/notifier/pacmanhelper/polkit/org.octopi.pacmanhelper.service ${pkgdir}/usr/share/dbus-1/system-services/org.octopi.pacmanhelper.service
-}
-
-package_octopi-notifier() {
-   pkgdesc="Notifier for Octopi"
-   depends=('octopi' 'libnotify')
-   optdepends=('xfce4-notifyd: for notifications in XFCE')
-
-   #Octopi-notifier file
-   install -D -m755 $startdir/notifier/bin/octopi-notifier ${pkgdir}/usr/bin/octopi-notifier
-   install -D -m644 $startdir/octopi-notifier.desktop ${pkgdir}/etc/xdg/autostart/octopi-notifier.desktop
+   for _subdir in $_subdirs; do
+     pushd $_subdir
+     make INSTALL_ROOT="${pkgdir}" install
+     popd
+   done   
 }

README

@@ -1,8 +0,0 @@
-This is Octopi, a powerful Pacman/Yaourt frontend using Qt libs. 
-
-The project's source code is hosted at https://github.com/aarnt/octopi.
-
-You'll need a privilege escalation tool to use it, once running as 
-root will not work. Octopi supports kdesu and gksu for that.
-
-Enjoy!

README.md

@@ -0,0 +1,148 @@
+## This is Octopi, a powerful Pacman/AUR front end using Qt libs.
+
+![Main window](https://raw.githubusercontent.com/aarnt/octopi/master/octopi-mainwindow.png)
+![Options dialog](https://raw.githubusercontent.com/aarnt/octopi/master/octopi-optionsdialog.png)
+![Main window with qss](https://raw.githubusercontent.com/aarnt/octopi/master/octopi-mainwindow-with-qss.png)
+
+The project site is hosted on https://tintaescura.com/projects/octopi
+
+Currently, 11 Linux distros are compatible with it
+
+ * [ArchBang](http://archbang.org/)
+ * [Archcraft](https://archcraft.io/)
+ * [Arch Linux](https://www.archlinux.org/)
+ * [ArcoLinux](https://arcolinux.info/)
+ * [Artix Linux](https://artixlinux.org)
+ * [CachyOS](https://cachyos.org/)
+ * [EndeavourOS](https://endeavouros.com/)
+ * [Garuda Linux](https://garudalinux.org/)
+ * [KaOS](https://kaosx.us/)
+ * [Manjaro](https://manjaro.org/)
+ * [Obarun Linux](https://web.obarun.org/index.php?id=1)
+
+### What you must install in order to have Octopi fully functional
+
+You'll need:
+ * [Alpm_octopi_utils](https://github.com/aarnt/alpm_octopi_utils/) library
+ * A helper to execute pacman commands called "octphelper", available on "./helper" dir
+ * A privilege escalation tool called [qt-sudo](https://github.com/aarnt/qt-sudo/)
+ * qtermwidget package, in order to build Octopi with embedded terminal support
+
+### To install Octopi using pacman
+
+If Octopi package is available in your distro's repository, you can just type:
+
+```
+# pacman -S octopi
+```
+
+### Steps to build Octopi source code (qmake)
+
+Assuming you have vala compiler and Qt6 libs properly installed, follow these steps:
+
+```
+$ git clone https://github.com/aarnt/alpm_octopi_utils
+$ cd alpm_octopi_utils
+$ make
+# make install
+$ cd ..
+$ git clone https://github.com/aarnt/qt-sudo
+$ cd qt-sudo
+$ qmake6
+$ make
+# make install
+$ cd ..
+$ git clone https://github.com/aarnt/octopi
+$ cd octopi/helper
+$ qmake6
+$ make
+# make install
+$ cd ../notifier
+$ qmake6
+$ make
+# make install
+$ cd ../cachecleaner
+$ qmake6
+$ make
+# make install
+$ cd ../repoeditor
+$ qmake6
+$ make
+# make install
+$ cd ..
+$ qmake6
+$ make
+# make install
+```
+
+You can also use the available PKGBUILD script that helps you build latest Octopi development version with all its tools(*):
+
+```
+$ cd OCTOPI_PATH (where you git cloned the source code)
+$ makepkg -f
+```
+
+(*) It may contain bugs. You have been warned.
+
+### Steps to build Octopi source code (CMake)
+
+As an alternative to qmake, Octopi can also be built with CMake. Make sure that at least CMake 3.5 is installed.
+
+First, build and install alpm_octopi_utils:
+
+```
+$ git clone https://github.com/aarnt/alpm_octopi_utils
+$ cd alpm_octopi_utils
+$ mkdir build_dir && cd build_dir
+$ cmake -G "Unix Makefiles" .. -DCMAKE_BUILD_TYPE=Release -DCMAKE_INSTALL_PREFIX=/usr
+$ make
+$ sudo make install
+```
+
+Next, build and install Octopi:
+
+```
+$ git clone https://github.com/aarnt/octopi
+$ cd octopi
+$ mkdir build_dir && cd build_dir
+$ cmake -G "Unix Makefiles" .. -DCMAKE_BUILD_TYPE=Release -DCMAKE_INSTALL_PREFIX=/usr
+$ make
+$ sudo make install
+```
+
+### To run Octopi
+
+```
+$ /usr/bin/octopi
+```
+
+### To run Octopi Notifier
+
+```
+$ /usr/bin/octopi-notifier
+```
+
+### To enable AUR support (that "green alien" icon on toolbar)
+
+You'll need to install [pacaur](https://github.com/rmarquis/pacaur), [paru](https://github.com/morganamilo/paru),
+[pikaur](https://github.com/actionless/pikaur), [trizen](https://github.com/trizen/trizen) or
+[yay](https://github.com/Jguer/yay) in your system.
+If neither of the previous tools are found Octopi will download latest "yay-bin" github binary.
+In KaOS, [kcp](https://codeberg.org/bvaudour/kcp) will be supported out of the box.
+
+### Ways to help/support Octopi
+
+ * You can "Star" it on the Github page - https://github.com/aarnt/octopi/
+ * You can vote in the AUR package available on https://aur.archlinux.org/packages/octopi/
+ * You can translate it to your mother language on https://explore.transifex.com/arnt/octopi/
+ * You can follow author's twitter account on https://twitter.com/aaarnt
+ * You can buy author's technical book (currently in portuguese) about Octopi and Qt5 on
+http://www.amazon.com.br/Aprendendo-Qt-com-projeto-Octopi-ebook/dp/B015ICHKV6
+ * You can buy author's poem book (currently in portuguese) on meditation, Buddhism, cosmology and other subjects on
+https://www.amazon.com.br/Avidya-Alexandre-Arnt-ebook/dp/B0965LVWR3
+ * You can write a review about it (text / video)
+ * You can donate money to the author's Paypal - http://sourceforge.net/donate/index.php?group_id=186459
+ * You can join the project ;-)
+
+
+Enjoy!

THANKS

@@ -6,14 +6,21 @@ A very special thanks goes to:
 - Bernardo M. Savone (Bersil), for testing and spreading the word 
 - Damián Nohales (eagleoneraptor), for pkgfile support
 - Edgar Aloísio Berger, for spreading the word by email
+- Filip Brcic (brcha), for KStatusNotifier support
+- Giuseppe Calà (gcala), for merging changes from Oktopi's code
+- Jordi (dmnmsc), for testing in Chakra Linux
 - Jose Martinez (dsngjoe), for testing under Cinnamon
 - Manjaro community, for testing and suggestions
 - Manuel Tortosa, for testing, suggestions and code
 - Philip Müller (philm), for testing, patches and suggestions
+- pdq, for implementing mooOS compatibility
 - Riberti de Almeida Felisbino (Holmes), for spreading the word at Manjaro Linux 
 Brasil
 - Ringo de kroon (ringo32), for testing and lots of suggestions
 - Sami Korkalainen (Sami-Perkele), for testing and suggestions
+- Thomas Binkau (tbinkau), for patches and suggestions
 - Valdir Rossi Belmonte Filho, for patching the site
+- vedgy, for patches and suggestions
+- Yoyo Fernández (Yoyo), for spreading the word and testing
 
 Octopi has got much better with all your help!

TRANSLATIONS

@@ -1,8 +1,15 @@
+To get a better picture of who are ALL Octopi translators, please access
+https://www.transifex.com/projects/p/octopi/. Bellow we have only a small 
+list of them:
+
 Arabic: karim (Karim Oulad Chalha)
+Asturian: Llumex03
+Basque: tarteka (Sergio Moreno)
 Brazilian Portuguese: arnt (Alexandre Albuquerque Arnt)
 Bulgarian: loot270 (Galin Iskrenov)
 Catalan: oriolfa (Oriol Fernandez)
 Chinese (Taiwan): s8321414 (冥王歐西里斯)
+Croatian: rokadar (Robert Okadar)
 Czech: fri
 Danish: Snubbi (Carl Andersen)
 Dutch: jsm (Jasper van der Marel)
@@ -10,12 +17,14 @@ English: source language
 English (Great Britain): jonathon (J Fernyhough)
 Finnish: Sami Korkalainen (Sami-Perkele)
 French: Loubrix (David Roux)
+Galician: Isorfe (Ismael Ordóñez)
 German: Veraendert
 Greek: angel_solomos
 Hebrew: GenghisKhan
 Hungarian: lajos (Lajos Pasztor)
 Indonesian: Se7enTime (Mohamad Hasan Al Banna)
 Italian: bersil (Bernardo Miguel Savone)
+Japanese: (UTUMI Hirosi) utuhiro78
 Lithuanian: liudas (Liudas Ališauskas)
 Malay: Puretech
 Norwegian Bokmål: viking60
@@ -26,7 +35,8 @@ Russian: macbet (Daniil) and ualmasov (Umidjon Almasov)
 Serbian: milenkin (Milena Petrović)
 Serbian-latin: GameBoyT (GameBoy)
 Slovak: roslav
-Spanish: tufadorin
+Spanish: tufadorin and yoyo308 (Yoyo Fernández)
+Spanish - Argentina: (javier)
 Spanish - Latin America: CostGranda (Cost Granda)
 Swedish: riiga
 Turkish: yfdogan (Yusuf Faruk DOĞAN)

cachecleaner/.tx/config

@@ -0,0 +1,11 @@
+[main]
+host = https://www.transifex.com
+
+[o:arnt:p:octopi:r:cachecleaner]
+file_filter            = resources/translations/octopi_cachecleaner_<lang>.ts
+source_file            = resources/translations/octopi_cachecleaner_en.ts
+source_lang            = en
+type                   = QT
+replace_edited_strings = false
+keep_translations      = false
+

cachecleaner/CMakeLists.txt

@@ -0,0 +1,66 @@
+if (USE_QTERMWIDGET6)
+  find_package(Qt6 REQUIRED COMPONENTS Core Network Xml Widgets LinguistTools)
+else()
+  find_package(Qt5 REQUIRED COMPONENTS Core Network Xml Widgets LinguistTools)
+endif()
+
+set(CMAKE_AUTOMOC ON)
+
+file(GLOB TS_FILES LIST_DIRECTORIES false "${CMAKE_CURRENT_LIST_DIR}/resources/translations/*.ts")
+qt_add_translation(qmFiles ${TS_FILES})
+
+set(src 
+    main.cpp
+    cachecleaner.cpp
+    packagegroupmodel.cpp
+    ../src/strconstants.cpp
+    ../src/qaesencryption.cpp
+    ../src/unixcommand.cpp
+    ../src/wmhelper.cpp
+    ../src/terminal.cpp
+    ../src/settingsmanager.cpp
+    ../src/searchlineedit.cpp
+    ../src/utils.cpp
+    ../src/package.cpp
+    ../src/QtSolutions/qtsingleapplication.cpp
+    ../src/QtSolutions/qtlocalpeer.cpp
+    #../src/QtSolutions/qtlockedfile.cpp
+    ../src/QtSolutions/qtsinglecoreapplication.cpp)
+
+set(header 
+    cachecleaner.h
+    packagegroupmodel.h
+    ../src/strconstants.h
+    ../src/qaesencryption.h
+    ../src/unixcommand.h
+    ../src/wmhelper.h
+    ../src/terminal.h
+    ../src/settingsmanager.h
+    ../src/searchlineedit.h
+    ../src/utils.h
+    ../src/package.h
+    ../src/QtSolutions/qtsingleapplication.h
+    ../src/QtSolutions/qtlocalpeer.h
+    #../src/QtSolutions/qtlockedfile.h
+    ../src/QtSolutions/qtsinglecoreapplication.h)
+
+set(ui ui/cachecleaner.ui)
+
+set(qrc resources.qrc)
+
+qt_wrap_ui(src ${ui})
+qt_add_resources(src ${qrc})
+    
+add_executable(octopi-cachecleaner ${src} ${header} ${qmFiles})
+target_compile_definitions(octopi-cachecleaner PRIVATE QT_USE_QSTRINGBUILDER QT_NO_CAST_FROM_ASCII QT_NO_CAST_TO_ASCII QT_NO_URL_CAST_FROM_STRING QT_NO_CAST_FROM_BYTEARRAY)
+
+if (USE_QTERMWIDGET6)
+  target_include_directories(octopi-cachecleaner PRIVATE ${CMAKE_CURRENT_BINARY_DIR} "${CMAKE_CURRENT_SOURCE_DIR}/src/QtSolutions" ${Qt6Core_INCLUDE_DIRS} ${Qt6Network_INCLUDE_DIRS} ${Qt6Xml_INCLUDE_DIRS} ${Qt6Widgets_INCLUDE_DIRS})
+  target_link_libraries(octopi-cachecleaner PRIVATE Qt6::Core Qt6::Network Qt6::Xml Qt6::Widgets)
+else()
+  target_include_directories(octopi-cachecleaner PRIVATE ${CMAKE_CURRENT_BINARY_DIR} "${CMAKE_CURRENT_SOURCE_DIR}/src/QtSolutions" ${Qt5Core_INCLUDE_DIRS} ${Qt5Network_INCLUDE_DIRS} ${Qt5Xml_INCLUDE_DIRS} ${Qt5Widgets_INCLUDE_DIRS})
+  target_link_libraries(octopi-cachecleaner PRIVATE Qt5::Core Qt5::Network Qt5::Xml Qt5::Widgets)
+endif()
+
+install(TARGETS octopi-cachecleaner RUNTIME DESTINATION bin LIBRARY DESTINATION lib PUBLIC_HEADER DESTINATION include)
+install(FILES "${CMAKE_CURRENT_SOURCE_DIR}/octopi-cachecleaner.desktop" DESTINATION share/applications)

cachecleaner/cachecleaner.cpp

@@ -0,0 +1,159 @@
+/*
+Copyright 2015 Michaël Lhomme
+
+This file is part of AppSet.
+
+AppSet is free software; you can redistribute it and/or modify
+it under the terms of the GNU General Public License as published by
+the Free Software Foundation; either version 2 of the License, or
+(at your option) any later version.
+
+AppSet is distributed in the hope that it will be useful,
+but WITHOUT ANY WARRANTY; without even the implied warranty of
+MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+GNU General Public License for more details.
+
+You should have received a copy of the GNU General Public License
+along with AppSet; if not, write to the Free Software
+Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA
+*/
+
+#include "cachecleaner.h"
+#include "ui_cachecleaner.h"
+#include "../src/strconstants.h"
+
+#include <QKeyEvent>
+#include <QTcpServer>
+#include <QTcpSocket>
+#include <QMessageBox>
+
+/*
+ * CacheCleaner window constructor
+ */
+CacheCleaner::CacheCleaner(QWidget *parent) :
+  QMainWindow(parent),
+  ui(new Ui::CacheCleaner)
+{
+  //UI initialization
+  ui->setupUi(this);
+
+  int keepInstalled = SettingsManager::getKeepNumInstalledPackages();
+  ui->keepInstalledPackagesSpinner->setValue(keepInstalled);
+
+  int keepUninstalled = SettingsManager::getKeepNumUninstalledPackages();
+  ui->keepUninstalledPackagesSpinner->setValue(keepUninstalled);
+
+  //create package group wrappers
+  m_installed = new PackageGroupModel(QLatin1String(""),
+                                      ui->installedPackagesList,
+                                      ui->keepInstalledPackagesSpinner,
+                                      ui->refreshInstalledButton,
+                                      ui->cleanInstalledButton);
+
+  m_uninstalled = new PackageGroupModel(QStringLiteral("-u"),
+                                        ui->uninstalledPackagesList,
+                                        ui->keepUninstalledPackagesSpinner,
+                                        ui->refreshUninstalledButton,                                                                                
+                                        ui->cleanUninstalledButton);
+
+  m_tcpServer = new QTcpServer(this);
+  connect(m_tcpServer, &QTcpServer::newConnection, this, &CacheCleaner::onSendInfoToOctopiHelper);
+
+  restoreGeometry(SettingsManager::getCacheCleanerWindowSize());
+}
+
+/*
+ * Cache Cleaner destructor
+ */
+CacheCleaner::~CacheCleaner()
+{
+  delete m_installed;
+  delete m_uninstalled;
+  delete ui;
+}
+
+/*
+ * Start listening for helper connections
+ */
+bool CacheCleaner::startServer()
+{
+  bool res=true;
+
+  if (!m_tcpServer->listen(QHostAddress::LocalHost, 12703))
+  {
+    QMessageBox::critical(this, StrConstants::getApplicationName(),
+                          QStringLiteral("Unable to start the server: %1.")
+                          .arg(m_tcpServer->errorString()));
+    res=false;
+  }
+
+  return res;
+}
+
+/*
+ * Answers Helper if CacheCleaner is executing actions
+ */
+void CacheCleaner::onSendInfoToOctopiHelper()
+{
+  QString msg;
+  QByteArray block;
+  QDataStream out(&block, QIODevice::WriteOnly);
+  out.setVersion(QDataStream::Qt_5_15);
+
+  //Is octopi-helper running?
+  bool isHelperExecuting=UnixCommand::isOctopiHelperRunning();
+
+  bool commandExecuting = (m_installed->isExecutingCommand || m_uninstalled->isExecutingCommand);
+
+  if (isHelperExecuting && commandExecuting)
+  {
+    msg=QLatin1String("Octopi est occupatus");
+    out << msg;
+  }
+  else if (isHelperExecuting && !commandExecuting)
+  {
+    msg=QLatin1String("Octopi serenum est");
+    out << msg;
+  }
+  else
+  {
+    msg=QLatin1String("Atramento nigro");
+    out << msg;
+  }
+
+  QTcpSocket *clientConnection = m_tcpServer->nextPendingConnection();
+  if (clientConnection->isOpen())
+  {
+    connect(clientConnection, &QAbstractSocket::disconnected,
+          clientConnection, &QObject::deleteLater);
+
+    clientConnection->write(block);
+    clientConnection->disconnectFromHost();
+  }
+
+  //m_installed->isExecutingCommand=false;
+  //m_uninstalled->isExecutingCommand=false;
+}
+
+/*
+ * Save settings when closing window
+ */
+void CacheCleaner::closeEvent(QCloseEvent *)
+{
+  QByteArray windowSize=saveGeometry();
+
+  SettingsManager::setCacheCleanerWindowSize(windowSize);
+  SettingsManager::setKeepNumInstalledPackages(ui->keepInstalledPackagesSpinner->value());
+  SettingsManager::setKeepNumUninstalledPackages(ui->keepUninstalledPackagesSpinner->value());
+}
+
+/*
+ * Whenever user presses ESC, we quit the program
+ */
+void CacheCleaner::keyPressEvent(QKeyEvent *ke)
+{
+  if (ke->key() == Qt::Key_Escape)
+  {
+    close();
+  }
+}

cachecleaner/cachecleaner.h

@@ -0,0 +1,60 @@
+/*
+Copyright 2015 Michaël Lhomme
+
+This file is part of AppSet.
+
+AppSet is free software; you can redistribute it and/or modify
+it under the terms of the GNU General Public License as published by
+the Free Software Foundation; either version 2 of the License, or
+(at your option) any later version.
+
+AppSet is distributed in the hope that it will be useful,
+but WITHOUT ANY WARRANTY; without even the implied warranty of
+MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+GNU General Public License for more details.
+
+You should have received a copy of the GNU General Public License
+along with AppSet; if not, write to the Free Software
+Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA
+*/
+
+#ifndef CACHECLEANER_H
+#define CACHECLEANER_H
+
+#include <QMainWindow>
+
+#include "packagegroupmodel.h"
+
+class QTcpServer;
+
+namespace Ui {
+class CacheCleaner;
+}
+
+/*
+ * Main CacheCleaner window
+ */
+class CacheCleaner : public QMainWindow
+{
+    Q_OBJECT
+
+private:
+    Ui::CacheCleaner *ui;
+    PackageGroupModel *m_installed;
+    PackageGroupModel *m_uninstalled;
+    QTcpServer *m_tcpServer;
+
+private slots:
+  void onSendInfoToOctopiHelper();
+
+public:
+    explicit CacheCleaner(QWidget *parent = 0);
+    ~CacheCleaner();
+    bool startServer();
+
+protected:
+    void closeEvent(QCloseEvent *);
+    void keyPressEvent(QKeyEvent *);
+};
+
+#endif // CACHECLEANER_H

cachecleaner/main.cpp

@@ -0,0 +1,94 @@
+/*
+Copyright 2015 Michaël Lhomme
+
+This file is part of AppSet.
+
+AppSet is free software; you can redistribute it and/or modify
+it under the terms of the GNU General Public License as published by
+the Free Software Foundation; either version 2 of the License, or
+(at your option) any later version.
+
+AppSet is distributed in the hope that it will be useful,
+but WITHOUT ANY WARRANTY; without even the implied warranty of
+MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+GNU General Public License for more details.
+
+You should have received a copy of the GNU General Public License
+along with AppSet; if not, write to the Free Software
+Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA
+*/
+
+#include "cachecleaner.h"
+#include "../src/strconstants.h"
+#include "../src/QtSolutions/qtsingleapplication.h"
+
+#include <QApplication>
+#include <QMessageBox>
+#include <QTranslator>
+#include <QLocale>
+#include <QLibraryInfo>
+#include <QtGui>
+
+int main( int argc, char *argv[] )
+{
+  unsetenv("TMPDIR");
+  QtSingleApplication app( QStringLiteral("Cache Cleaner - Octopi"), argc, argv );
+
+  //If there is already an instance running...
+  if (app.isRunning())
+  {
+    app.sendMessage(QStringLiteral("RAISE"));
+    return 0;
+  }
+
+  app.sendMessage(QStringLiteral("RAISE"));
+
+  QTranslator appTranslator;
+  bool success = appTranslator.load(QLatin1String(":/resources/translations/octopi_cachecleaner_") +
+                     QLocale::system().name()); 
+  if (!success)
+  {
+    success = appTranslator.load(QStringLiteral(":/resources/translations/octopi_cachecleaner_en.qm"));
+  }
+
+  app.installTranslator(&appTranslator);
+
+  if (UnixCommand::isRootRunning()){
+    QMessageBox::critical( nullptr, StrConstants::getApplicationName(), StrConstants::getErrorRunningWithRoot());
+    return (-2);
+  }
+
+  if (!UnixCommand::hasTheExecutable(QStringLiteral("paccache")))
+  {
+    QMessageBox::critical( nullptr, StrConstants::getApplicationName(), StrConstants::getExecutableCouldNotBeFound().arg(QStringLiteral("\"paccache\"")));
+    return (-3);
+  }
+
+  if (!QFile::exists(ctn_OCTOPI_HELPER_PATH))
+  {
+    qDebug() << "Aborting cache-cleaner as 'octphelper' binary could not be found! [" << ctn_OCTOPI_HELPER_PATH << "]";
+    return (-4);
+  }
+
+  if (!QFile::exists(ctn_OCTOPISUDO))
+  {
+    qDebug() << "Aborting cache-cleaner as 'octopi-sudo' binary could not be found! [" << ctn_OCTOPISUDO << "]";
+    return (-5);
+  }
+
+  if (!UnixCommand::isOctoToolRunning(QStringLiteral("octopi-cachecleaner")))
+  {
+    QMessageBox::critical(nullptr, StrConstants::getApplicationName(), StrConstants::getErrorRunOctopiCacheCleanerAsUsrBin());
+    return (-6);
+  }
+
+  CacheCleaner w;
+  if (w.startServer())
+  {
+    app.setActivationWindow(&w);
+    w.show();
+    QResource::registerResource(QStringLiteral("./resources.qrc"));
+
+    return app.exec();
+  }
+}

cachecleaner/octopi-cachecleaner.desktop

@@ -0,0 +1,11 @@
+[Desktop Entry]
+Name=Octopi CacheCleaner
+Icon=octopi
+Exec=/usr/bin/octopi-cachecleaner
+Terminal=false
+Type=Application
+Categories=GNOME;GTK;System;
+#NotShowIn=GNOME;XFCE;LXDE;KDE;
+StartupNotify=true
+Version=1.5
+SingleMainWindow=true

cachecleaner/octopi-cachecleaner.pro

@@ -0,0 +1,132 @@
+#-------------------------------------------------
+#
+# Project created by QtCreator 2013-02-21T18:57:08
+#
+#-------------------------------------------------
+
+QT += core gui network xml widgets
+
+CONFIG += qt console warn_on debug
+
+# Disable automatic string conversions
+DEFINES += QT_USE_QSTRINGBUILDER \
+           QT_NO_CAST_FROM_ASCII \
+           QT_NO_CAST_TO_ASCII \
+           QT_NO_URL_CAST_FROM_STRING \
+           QT_NO_CAST_FROM_BYTEARRAY
+
+TEMPLATE = app
+DESTDIR += bin
+OBJECTS_DIR += build
+MOC_DIR += build
+UI_DIR += build
+
+HEADERS +=  cachecleaner.h \
+            packagegroupmodel.h \
+            ../src/strconstants.h \
+            ../src/qaesencryption.h \
+            ../src/unixcommand.h \
+            ../src/wmhelper.h \
+            ../src/terminal.h \
+            ../src/settingsmanager.h \
+            ../src/searchlineedit.h \
+            ../src/utils.h \
+            ../src/package.h \
+            ../src/QtSolutions/qtsingleapplication.h \
+            ../src/QtSolutions/qtlocalpeer.h \
+            ../src/QtSolutions/qtlockedfile.h \
+            ../src/QtSolutions/qtsinglecoreapplication.h
+    
+
+SOURCES +=  main.cpp \
+            cachecleaner.cpp \
+            packagegroupmodel.cpp \
+            ../src/strconstants.cpp \
+            ../src/qaesencryption.cpp \
+            ../src/unixcommand.cpp \
+            ../src/wmhelper.cpp \
+            ../src/terminal.cpp \
+            ../src/settingsmanager.cpp \
+            ../src/searchlineedit.cpp \
+            ../src/utils.cpp \
+            ../src/package.cpp \
+            ../src/QtSolutions/qtsingleapplication.cpp \
+            ../src/QtSolutions/qtlocalpeer.cpp \
+            ../src/QtSolutions/qtlockedfile.cpp \
+            ../src/QtSolutions/qtsinglecoreapplication.cpp
+
+FORMS +=  ui/cachecleaner.ui
+
+RESOURCES += resources.qrc
+    
+TRANSLATIONS += resources/translations/octopi_cachecleaner_pt_BR.ts \
+    resources/translations/octopi_cachecleaner_fr_FR.ts \
+    resources/translations/octopi_cachecleaner_fr.ts \
+    resources/translations/octopi_cachecleaner_es_ES.ts \
+    resources/translations/octopi_cachecleaner_es_419.ts \
+    resources/translations/octopi_cachecleaner_es_AR.ts \
+    resources/translations/octopi_cachecleaner_el.ts \
+    resources/translations/octopi_cachecleaner_de.ts \
+    resources/translations/octopi_cachecleaner_it.ts \
+    resources/translations/octopi_cachecleaner_ro.ts \
+    resources/translations/octopi_cachecleaner_tr_TR.ts \
+    resources/translations/octopi_cachecleaner_ar.ts \
+    resources/translations/octopi_cachecleaner_ca.ts \
+    resources/translations/octopi_cachecleaner_bg.ts \
+    resources/translations/octopi_cachecleaner_pl.ts \
+    resources/translations/octopi_cachecleaner_id.ts \
+    resources/translations/octopi_cachecleaner_da.ts \
+    resources/translations/octopi_cachecleaner_cs.ts \
+    resources/translations/octopi_cachecleaner_he.ts \
+    resources/translations/octopi_cachecleaner_hi.ts \
+    resources/translations/octopi_cachecleaner_hi_IN.ts \
+    resources/translations/octopi_cachecleaner_lt.ts \
+    resources/translations/octopi_cachecleaner_nb.ts \
+    resources/translations/octopi_cachecleaner_sr@latin.ts \
+    resources/translations/octopi_cachecleaner_sr_RS.ts \
+    resources/translations/octopi_cachecleaner_nl.ts \
+    resources/translations/octopi_cachecleaner_ru.ts \
+    resources/translations/octopi_cachecleaner_uz.ts \
+    resources/translations/octopi_cachecleaner_fi.ts \
+    resources/translations/octopi_cachecleaner_fi_FI.ts \
+    resources/translations/octopi_cachecleaner_vi.ts \
+    resources/translations/octopi_cachecleaner_en_GB.ts \
+    resources/translations/octopi_cachecleaner_pt_PT.ts \
+    resources/translations/octopi_cachecleaner_sv.ts \
+    resources/translations/octopi_cachecleaner_sl.ts \
+    resources/translations/octopi_cachecleaner_hu.ts \
+    resources/translations/octopi_cachecleaner_zh_TW.ts \
+    resources/translations/octopi_cachecleaner_ms_MY.ts \
+    resources/translations/octopi_cachecleaner_uk.ts \
+    resources/translations/octopi_cachecleaner_sk.ts \
+    resources/translations/octopi_cachecleaner_ja.ts \
+    resources/translations/octopi_cachecleaner_eu.ts \
+    resources/translations/octopi_cachecleaner_gl_ES.ts \
+    resources/translations/octopi_cachecleaner_ast.ts \
+    resources/translations/octopi_cachecleaner_hr.ts \
+    resources/translations/octopi_cachecleaner_zh-Hans.ts \
+    resources/translations/octopi_cachecleaner_zh_CN.ts \
+    resources/translations/octopi_cachecleaner_ko.ts \
+    resources/translations/octopi_cachecleaner_ko_KR.ts \
+    
+# install
+isEmpty(PREFIX) {
+    PREFIX = /usr
+}
+ 
+isEmpty(BINDIR) {
+    BINDIR = $$PREFIX/bin
+}
+
+isEmpty(DATADIR) {
+    DATADIR = $$PREFIX/share
+}
+    
+target.path = $$BINDIR
+sources.files = $$SOURCES $$HEADERS $$RESOURCES $$FORMS *.pro 
+sources.path = .
+
+desktop.path = $$DATADIR/applications
+desktop.files += cachecleaner/octopi-cachecleaner.desktop
+
+INSTALLS += target desktop

cachecleaner/packagegroupmodel.cpp

@@ -0,0 +1,283 @@
+/*
+Copyright 2015 Michaël Lhomme
+
+This file is part of AppSet.
+
+AppSet is free software; you can redistribute it and/or modify
+it under the terms of the GNU General Public License as published by
+the Free Software Foundation; either version 2 of the License, or
+(at your option) any later version.
+
+AppSet is distributed in the hope that it will be useful,
+but WITHOUT ANY WARRANTY; without even the implied warranty of
+MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+GNU General Public License for more details.
+
+You should have received a copy of the GNU General Public License
+along with AppSet; if not, write to the Free Software
+Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA
+*/
+
+#include "packagegroupmodel.h"
+#include "../src/strconstants.h"
+
+#include <QSharedMemory>
+#include <QApplication>
+#include <QMessageBox>
+
+/*
+ * Constructor
+ *
+ * @param listView The list view to display packages
+ * @param spinner The spinner to configure the number of archive to keep
+ * @param refreshBtn The refresh view button
+ * @param cleanBtn The clean button
+ */
+PackageGroupModel::PackageGroupModel(QString optionsString,
+                                     QListWidget *listView,
+                                     QSpinBox *spinner,
+                                     QPushButton *refreshBtn,
+                                     QPushButton *cleanBtn)
+                                        : QObject(nullptr),
+                                        m_optionsString(optionsString), 
+                                        m_listView(listView), 
+                                        m_spinner(spinner), 
+                                        m_refreshButton(refreshBtn),
+                                        m_cleanButton(cleanBtn),
+                                        m_cmd(new UnixCommand(this)),
+                                        m_acc(new ProcessOutputAccumulator(m_cmd)),
+                                        m_oldKeepValue(spinner->value())
+{
+  m_cleanButton->setText(tr("Clean"));
+
+  m_sharedMemory=new QSharedMemory(QStringLiteral("org.arnt.octopi"), this);
+
+  //setup UI slots
+  connect( m_spinner, SIGNAL( valueChanged(int) ), SLOT( updateKeepArchives() ) );
+  connect( m_spinner, SIGNAL( valueChanged(int) ), SLOT( refreshCacheView() ) );
+  connect( m_spinner, SIGNAL( editingFinished() ), SLOT( keepArchivesChanged() ) );
+  connect( m_refreshButton, SIGNAL( clicked() ), SLOT( refreshCacheView() ) );
+  connect( m_cleanButton, SIGNAL( clicked() ), SLOT( cleanCache() ) );
+
+  isExecutingCommand = false;
+
+  //refresh cache informations at startup
+  refreshCacheView();
+}
+
+/*
+ * Destructor
+ */
+PackageGroupModel::~PackageGroupModel()
+{
+  //UnixCommand::removeSharedMemFiles();
+  delete m_acc;
+  delete m_cmd;
+}
+
+/*
+ * Handle spinner change: disable the clean button
+ * to ensure consistency between the list and what
+ * will effectively be cleared if the user press
+ * the button
+ */
+void PackageGroupModel::updateKeepArchives()
+{
+  m_cleanButton->setEnabled(false);
+}
+
+/*
+ * Refresh the cache when the spinner change are validated
+ */
+void PackageGroupModel::keepArchivesChanged()
+{
+  if(m_spinner->value() != m_oldKeepValue)
+    refreshCacheView();
+}
+
+/*
+ * Return the options to pass to paccache according to the current context
+ */
+QString PackageGroupModel::getOptions()
+{
+  return QStringLiteral("%1-k %2").arg(m_optionsString).arg(m_spinner->value());
+}
+
+/*
+ * Refresh the view
+ */
+void PackageGroupModel::refreshCacheView()
+{
+  if (isExecutingCommand) return;
+
+  //update UI for background refresh
+  QApplication::setOverrideCursor(Qt::WaitCursor);
+  m_acc->reset();
+  m_refreshButton->setEnabled(false);
+  m_cleanButton->setEnabled(false);
+  m_listView->clear();
+
+  m_oldKeepValue = m_spinner->value();
+
+  //connect handler slot and call the command
+  QObject::connect(m_cmd, SIGNAL( finished ( int, QProcess::ExitStatus )),
+                   this, SLOT( finishedDryrun ( int, QProcess::ExitStatus )) );
+
+  QStringList sl;
+  sl << QStringLiteral("-v");
+  sl << QStringLiteral("-d");
+  QStringList opt = getOptions().split(QStringLiteral(" "), Qt::SkipEmptyParts);
+  sl << opt;
+  m_cmd->executeCommandAsNormalUser(QStringLiteral("/usr/bin/paccache"), sl);
+  isExecutingCommand = true;
+}
+
+/*
+ * Checks if some SU utility is available...
+ * Returns false if not!
+ */
+bool PackageGroupModel::isSUAvailable()
+{
+  //If there are no means to run the actions, we must warn!
+  if (UnixCommand::isRootRunning() && WMHelper::isKDERunning())
+  {
+    return true;
+  }
+  else if (WMHelper::getSUCommand() == ctn_NO_SU_COMMAND){
+    QMessageBox::critical( nullptr, StrConstants::getApplicationName(),
+                           StrConstants::getErrorNoSuCommand() +
+                           QLatin1String("\n") + StrConstants::getYoullNeedSuFrontend());
+    return false;
+  }
+  else
+    return true;
+}
+
+/*
+ * Call paccache to effectively clear the cache
+ */
+void PackageGroupModel::cleanCache()
+{
+  if (isExecutingCommand || UnixCommand::isPacmanDbLocked()){
+    QMessageBox::critical( nullptr, StrConstants::getApplicationName(),
+                           StrConstants::getErrorDbLock());
+    return;
+  }
+
+  if (!isSUAvailable())
+    return;
+
+  //update UI buttons
+  QApplication::setOverrideCursor(Qt::WaitCursor);
+  m_acc->reset();
+  m_refreshButton->setEnabled(false);
+  m_cleanButton->setEnabled(false);
+
+  //connect handler slot and call the command
+  QObject::connect(m_cmd, SIGNAL( finished ( int, QProcess::ExitStatus )),
+                   this, SLOT( finishedClean( int, QProcess::ExitStatus )) );
+
+  isExecutingCommand = true;
+  const QString tmp = QLatin1String("paccache -r ") + getOptions();
+  //UnixCommand::removeTemporaryFiles();
+  m_cmd->executeCommandWithSharedMemHelper(tmp, m_sharedMemory);
+}
+
+/*
+ * Handle the result of the refresh action
+ */
+void PackageGroupModel::finishedDryrun(int exitCode, QProcess::ExitStatus)
+{
+  //disconnect the handler
+  QObject::disconnect(m_cmd, SIGNAL( finished ( int, QProcess::ExitStatus )),
+                      this, SLOT( finishedDryrun ( int, QProcess::ExitStatus )) );
+
+  QApplication::restoreOverrideCursor();
+
+  isExecutingCommand = false;
+
+  if(exitCode > 1)
+  {
+    //process failed, provide info on errors
+    QMessageBox::critical(m_listView, QStringLiteral("Error with the underlying process"), m_acc->getErrors());
+  }
+  else if (exitCode == 0)
+  {
+    //process finished successfully, process the resulting output
+    processDryrunResult(m_acc->getOutput());
+  }
+
+  //in either case, reenable the refresh button
+  m_refreshButton->setEnabled(true);
+}
+
+/*
+ * Handle the result of the clean action
+ */
+void PackageGroupModel::finishedClean(int exitCode, QProcess::ExitStatus)
+{
+  //disconnect the handler
+  QObject::disconnect(m_cmd, SIGNAL( finished ( int, QProcess::ExitStatus ) ),
+                      this, SLOT( finishedClean(int, QProcess::ExitStatus ) ) );
+
+  QApplication::restoreOverrideCursor();
+
+  isExecutingCommand = false;
+
+  if(exitCode != 0)
+  {
+    //process failed, return to main window
+    m_refreshButton->setEnabled(true);
+    m_cleanButton->setEnabled(true);
+  }
+  else
+  {
+    //refresh the view
+    refreshCacheView();
+  }
+}
+
+/*
+ * Process the output of the refresh commands
+ *
+ * @param output The output of the dryrun process
+ */
+void PackageGroupModel::processDryrunResult(QString output) {
+  QStringList lines = output.split(QRegularExpression(QStringLiteral("\\n")), Qt::SkipEmptyParts);
+
+  if(lines.length() == 1 || output.contains(QLatin1String("*.pkg.tar?(.+([^.]))")))
+  {
+    //"==> no candidate packages found for pruning"
+    m_cleanButton->setText(tr("Clean"));
+  }
+  else
+  {
+    //process package list
+    for(int i = 0; i < lines.length(); i++)
+    {
+      const QString& line = lines.at(i);
+
+      if(i == 0)
+        //skip the first line ("==> Candidate packages:")
+        continue;
+
+      else if(i == lines.length() - 1)
+      {
+        //extract size from "==> finished dry run: 8 candidates (disk space saved: 19.11 MiB)")
+        QStringList components = line.split(QStringLiteral(" "));
+
+        QString unit = components.takeLast();
+        unit.remove(unit.length() - 1, 1);
+
+        QString size = components.takeLast();
+
+        m_cleanButton->setText(tr("Clean %1").arg(QLatin1Char(' ') + size + QLatin1Char(' ') + unit));
+      }
+      else
+        m_listView->addItem(line);
+    }
+
+    //there is packages to clean so reenable the clean button
+    m_cleanButton->setEnabled(true);
+  }
+}

cachecleaner/packagegroupmodel.h

@@ -0,0 +1,114 @@
+/*
+Copyright 2015 Michaël Lhomme
+
+This file is part of AppSet.
+
+AppSet is free software; you can redistribute it and/or modify
+it under the terms of the GNU General Public License as published by
+the Free Software Foundation; either version 2 of the License, or
+(at your option) any later version.
+
+AppSet is distributed in the hope that it will be useful,
+but WITHOUT ANY WARRANTY; without even the implied warranty of
+MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+GNU General Public License for more details.
+
+You should have received a copy of the GNU General Public License
+along with AppSet; if not, write to the Free Software
+Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA
+*/
+
+#ifndef PACKAGEGROUP_H
+#define PACKAGEGROUP_H
+
+#include <QObject>
+#include <QSpinBox>
+#include <QListWidget>
+#include <QPushButton>
+
+#include "../src/unixcommand.h"
+#include "../src/wmhelper.h"
+
+/*
+ * Helper class to accumulate UnixCommand standard and error output
+ * on the fly
+ */
+class ProcessOutputAccumulator : QObject
+{
+  Q_OBJECT
+
+public:
+  ProcessOutputAccumulator(UnixCommand *cmd) {
+    m_unixCommand = cmd;
+
+    //connect(m_unixCommand, SIGNAL( started() ), SLOT( reset() ) );
+    connect(m_unixCommand, SIGNAL( readyReadStandardOutput() ), SLOT( standardOutputAvailable() ) );
+    connect(m_unixCommand, SIGNAL( readyReadStandardError() ), SLOT( errorsOutputAvailable() ) );
+  }
+
+  QString getOutput() { return m_standardOutput; }
+  QString getErrors() { return m_errorsOutput; }
+
+public slots:
+
+  void reset()
+  {
+    m_standardOutput.clear();
+    m_errorsOutput.clear();
+  }
+
+  void standardOutputAvailable()
+  {
+    m_standardOutput.append(m_unixCommand->readAllStandardOutput());
+  }
+
+  void errorsOutputAvailable()
+  {
+    m_errorsOutput.append(m_unixCommand->readAllStandardError());
+  }
+
+protected:
+  UnixCommand *m_unixCommand;
+  QString m_standardOutput;
+  QString m_errorsOutput;
+};
+
+/*
+ * Wrapper to encapsulate operation on package groups (installed and uninstalled)
+ */
+class PackageGroupModel : public QObject
+{
+    Q_OBJECT
+
+private:
+  bool isSUAvailable();
+  QSharedMemory *m_sharedMemory;
+
+public:
+    PackageGroupModel(QString, QListWidget *, QSpinBox *, QPushButton *, QPushButton *);
+    ~PackageGroupModel();
+    bool isExecutingCommand;
+
+protected:
+    QString m_optionsString;
+    QListWidget *m_listView;
+    QSpinBox *m_spinner;
+    QPushButton *m_refreshButton;
+    QPushButton *m_cleanButton;
+    UnixCommand *m_cmd;
+    ProcessOutputAccumulator *m_acc;
+    int m_oldKeepValue;
+
+    void processDryrunResult(QString);
+    QString getOptions();
+
+public slots:
+    void refreshCacheView();
+    void cleanCache();
+    void updateKeepArchives();
+    void keepArchivesChanged();
+    void finishedDryrun(int, QProcess::ExitStatus);
+    void finishedClean(int, QProcess::ExitStatus);
+};
+
+#endif // PACKAGEGROUP_H

cachecleaner/resources.qrc

@@ -0,0 +1,54 @@
+<RCC>
+    <qresource prefix="/">
+        <file>resources/images/cachecleaner.png</file>
+        <file>resources/translations/octopi_cachecleaner_ar.qm</file>
+        <file>resources/translations/octopi_cachecleaner_ast.qm</file>
+        <file>resources/translations/octopi_cachecleaner_bg.qm</file>
+        <file>resources/translations/octopi_cachecleaner_ca.qm</file>
+        <file>resources/translations/octopi_cachecleaner_cs.qm</file>
+        <file>resources/translations/octopi_cachecleaner_da.qm</file>
+        <file>resources/translations/octopi_cachecleaner_de.qm</file>
+        <file>resources/translations/octopi_cachecleaner_el.qm</file>
+        <file>resources/translations/octopi_cachecleaner_en_GB.qm</file>
+        <file>resources/translations/octopi_cachecleaner_en.qm</file>
+        <file>resources/translations/octopi_cachecleaner_es_419.qm</file>
+        <file>resources/translations/octopi_cachecleaner_es_AR.qm</file>
+        <file>resources/translations/octopi_cachecleaner_es_ES.qm</file>
+        <file>resources/translations/octopi_cachecleaner_eu.qm</file>
+        <file>resources/translations/octopi_cachecleaner_fi.qm</file>
+        <file>resources/translations/octopi_cachecleaner_fi_FI.qm</file>
+        <file>resources/translations/octopi_cachecleaner_fr_FR.qm</file>
+        <file>resources/translations/octopi_cachecleaner_fr.qm</file>
+        <file>resources/translations/octopi_cachecleaner_he.qm</file>
+        <file>resources/translations/octopi_cachecleaner_hi.qm</file>
+        <file>resources/translations/octopi_cachecleaner_hi_IN.qm</file>
+        <file>resources/translations/octopi_cachecleaner_hu.qm</file>
+        <file>resources/translations/octopi_cachecleaner_id.qm</file>
+        <file>resources/translations/octopi_cachecleaner_it.qm</file>
+        <file>resources/translations/octopi_cachecleaner_ja.qm</file>
+        <file>resources/translations/octopi_cachecleaner_lt.qm</file>
+        <file>resources/translations/octopi_cachecleaner_ms_MY.qm</file>
+        <file>resources/translations/octopi_cachecleaner_nb.qm</file>
+        <file>resources/translations/octopi_cachecleaner_nl.qm</file>
+        <file>resources/translations/octopi_cachecleaner_pl.qm</file>
+        <file>resources/translations/octopi_cachecleaner_pt_BR.qm</file>
+        <file>resources/translations/octopi_cachecleaner_pt_PT.qm</file>
+        <file>resources/translations/octopi_cachecleaner_ro.qm</file>
+        <file>resources/translations/octopi_cachecleaner_ru.qm</file>
+        <file>resources/translations/octopi_cachecleaner_sk.qm</file>
+        <file>resources/translations/octopi_cachecleaner_sr@latin.qm</file>
+        <file>resources/translations/octopi_cachecleaner_sr_RS.qm</file>
+        <file>resources/translations/octopi_cachecleaner_sv.qm</file>
+        <file>resources/translations/octopi_cachecleaner_sl.qm</file>
+        <file>resources/translations/octopi_cachecleaner_tr_TR.qm</file>
+        <file>resources/translations/octopi_cachecleaner_tr.qm</file>
+        <file>resources/translations/octopi_cachecleaner_uk.qm</file>
+        <file>resources/translations/octopi_cachecleaner_uz.qm</file>
+        <file>resources/translations/octopi_cachecleaner_vi.qm</file>
+        <file>resources/translations/octopi_cachecleaner_zh_TW.qm</file>
+        <file>resources/translations/octopi_cachecleaner_zh-Hans.qm</file>
+        <file>resources/translations/octopi_cachecleaner_zh_CN.qm</file>
+        <file>resources/translations/octopi_cachecleaner_hr.qm</file>
+        <file>resources/translations/octopi_cachecleaner_ko.qm</file>
+    </qresource>
+</RCC>

cachecleaner/resources/translations/octopi_cachecleaner_af.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="af" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_af_ZA.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="af_ZA" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_ar.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="ar" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation>منظف الكاش - Octopi</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation>حزم غير مثبتة</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation>إحتفظ:</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation>عدد النُسخ القديمة للإبقاء عليها</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation>تحديث</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation>حزم مثبتة</translation>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation>مسح</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation>إمسح %1</translation>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_ast.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="ast" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation>Llimpiador de la caché - Octopi</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation>Paquetes desinstalaos</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation>Caltener:</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation>Númberu de versiones vieyes a caltener</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation>Refrescar</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation>Paquetes instalaos</translation>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation>Llimpiar</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation>Llimpiar %1</translation>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_be.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="be" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_be_BY.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="be_BY" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_bg.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="bg" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation>Почистване на кеша - „Octopi“</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation>Премахнати пакети</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation>Запази :</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation>Брой на старите версии за запазване</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation>Опресняване</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation>Инсталирани пакети</translation>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation>Почистване</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation>Почистване на %1</translation>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_bs.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="bs" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_bs_BA.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="bs_BA" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation>Keš čistač - Octopi</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation>Deinstalirani paketi</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation>Zadrži</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation>Zadržati broj starih verzija</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation>Osvježi</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation>Instalirani paketi</translation>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation>Očisti</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation>Očisti %1</translation>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_ca.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="ca" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation>Netejador de la cau - Octopi</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation>Paquets desinstal·lats</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation>Mantén:</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation>Quantitat de versions antigues a mantenir:</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation>Refresca</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation>Paquets instal·lats</translation>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation>Neteja</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation>Neteja %1</translation>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_cmn.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="cmn" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_cs.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="cs" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation>Čistič vyrovnávací paměti</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation>Odinstalované balíčky</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation>Zachovat :</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation>Počet starých verzí k zachování</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation>Obnovit</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation>Nainstalované balíčky</translation>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation>Vyčistit</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation>Vyčistit %1</translation>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_cs_CZ.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="cs_CZ" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_da.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="da" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation>Cache-renser - Octopi</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation>Afinstallerede pakker</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation>Behold :</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation>Antal gamle versioner der skal beholdes</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation>Genopfrisk</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation>Installerede pakker</translation>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation>Rens</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation>Rens %1</translation>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_de.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="de" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation>Zwischenspeicher säubern - Octopi</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation>Deinstallierte Pakete</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation>Behalten:</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation>Anzahl der alten Versionen, die behalten werden: </translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation>Aktualisieren</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation>Installierte Pakete</translation>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation>Säubern</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation>Säubere %1</translation>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_de_AT.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="de_AT" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_de_DE.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="de_DE" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_el.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="el" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation>Καθαριστικό μνήμης cache - Octopi</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation>Μη εγκατεστημένα πακέτα</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation>Διατηρηση:</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation>Αριθμός των παλαιών εκδόσεων για διατηρηση</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation>Ανανέωση</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation>Εγκατεστημένα πακέτα</translation>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation>Εκκαθαριση</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation>Εκκαθαριση %1</translation>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_en.ts

@@ -0,0 +1,55 @@
+<?xml version="1.0" encoding="utf-8"?>
+<!DOCTYPE TS>
+<TS version="2.1" language="en_US">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="../../ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation type="unfinished"></translation>
+    </message>
+    <message>
+        <location filename="../../ui/cachecleaner.ui" line="31"/>
+        <source>Uninstalled packages</source>
+        <translation type="unfinished"></translation>
+    </message>
+    <message>
+        <location filename="../../ui/cachecleaner.ui" line="42"/>
+        <source>Keep : </source>
+        <translation type="unfinished"></translation>
+    </message>
+    <message>
+        <location filename="../../ui/cachecleaner.ui" line="65"/>
+        <location filename="../../ui/cachecleaner.ui" line="134"/>
+        <source>Refresh</source>
+        <translation type="unfinished"></translation>
+    </message>
+    <message>
+        <location filename="../../ui/cachecleaner.ui" line="72"/>
+        <location filename="../../ui/cachecleaner.ui" line="141"/>
+        <location filename="../../cachecleaner.cpp" line="282"/>
+        <source>Clean</source>
+        <translation type="unfinished"></translation>
+    </message>
+    <message>
+        <location filename="../../ui/cachecleaner.ui" line="90"/>
+        <source>Installed packages</source>
+        <translation type="unfinished"></translation>
+    </message>
+    <message>
+        <location filename="../../ui/cachecleaner.ui" line="101"/>
+        <source>Keep :</source>
+        <translation type="unfinished"></translation>
+    </message>
+    <message>
+        <location filename="../../ui/cachecleaner.ui" line="108"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"></translation>
+    </message>
+    <message>
+        <location filename="../../cachecleaner.cpp" line="303"/>
+        <source>Clean </source>
+        <translation type="unfinished"></translation>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_en_CZ.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="en_CZ" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_en_GB.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="en_GB" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation>Cache Cleaner - Octopi</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation>Uninstalled packages</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation>Keep :</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation>Number of old versions to keep</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation>Refresh</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation>Installed packages</translation>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation>Clean</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation>Clean %1</translation>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_en_IN.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="en_IN" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_en_PL.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="en_PL" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_en_SE.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="en_SE" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_eo.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="eo" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation>Malinstalitaj Pakaĵoj</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation>Konservi :</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation>Refreŝigi</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation>Instalitaj Pakaĵoj</translation>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation>Purigi</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation>Purigi %1</translation>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_es.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="es" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation>Limpiador de caché</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation>Paquetes desinstalados</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation>Mantener:</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation>Número de versiones antiguas a mantener</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation>Refrescar</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation>Paquetes instalados</translation>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation>Limpiar</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation>Limpiar %1</translation>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_es_419.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="es_419" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation>Limpiador de Cache - Octopi</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation>Paquetes desinstalados</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation>Mantener :</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation>Número de versión anterior a mantener</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation>Actualizar</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation>Paquetes instalados</translation>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation>Limpiar</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation>Limpiar %1</translation>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_es_AR.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="es_AR" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation>Limpiador de Caché - Octopi</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation>Paquetes desinstalados</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation>Conservar:</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation>Número de versiones antiguas para conservar</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation>Refrescar</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation>Paquetes instalados</translation>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation>Limpiar</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation>Limpiar %1</translation>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_es_CL.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="es_CL" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation>Limpiador Cache-Octopi</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation>Paquetes desinstalados</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation>Mantener :</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation>Número de versiones anteriores a mantener</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation>Refrescar</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation>Paquetes instalados</translation>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation>Limpiar</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation>Limpiar %1</translation>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_es_CR.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="es_CR" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_es_ES.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="es_ES" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation>Limpiador de Caché - Octopi</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation>Paquetes desinstalados</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation>Conservar :</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation>Número de versiones antiguas a conservar:</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation>Refrescar</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation>Paquetes instalados</translation>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation>Limpiar</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation>Limpiar %1</translation>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_es_MX.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="es_MX" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation>Limpiador de Caché - Octopi</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation>Paquetes desinstalados</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation>Conservar:</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation>Número de versión anterior a conservar</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation>Actualizar</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation>Paquetes instalados</translation>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation>Limpiar</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation>Limpiar %1</translation>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_es_NI.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="es_NI" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_es_PE.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="es_PE" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation>Borrar Cache - Octopi</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation>Refrescar</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation>Borrar</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_eu.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="eu" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation>Cache Garbitzailea - Octopi</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation>Ezabatutako paketeak</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation>Mantendu :</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation>Zenbat bertsio zahar mantendu</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation>Eguneratu</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation>Instalatutako paketeak</translation>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation>Garbitu</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation>%1 Garbitu</translation>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_fa_IR.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="fa_IR" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation>Cache Cleaner - Octopi</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation>بسته های حذف شده</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation>نگه‌داری</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation>تعداد ورژن‌هایی که باقی می‌مانند</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation>تازه سازی</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation>بسته های نصب شده</translation>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation>تمیز کردن</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation>پاک کردن 1%</translation>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_fi.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="fi" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation>Välimuistin tyhjennys - Octopi</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation>Asentamattomat paketit</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation>Säilytä:</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation>Säilytettävien vanhojen versioiden määrä</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation>Päivitä</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation>Asennetut paketit</translation>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation>Tyhjennä</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation>Tyhjennä %1</translation>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_fi_FI.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="fi_FI" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation>Välimuistin tyhjennys - Octopi</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation>Asentamattomat paketit</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation>Säilytä:</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation>Säilytettävien vanhojen versioiden lukumäärä</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation>Päivitä</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation>Asennetut paketit</translation>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation>Tyhjennä</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation>Tyhjennä %1</translation>
+    </message>
+</context>
+</TS>