- Bugfix in refresh

Show current version of the packages on the System Upgrade window

.gitignore

@@ -1,9 +1,33 @@
+*.user
+.qmake.stash
+.qtc_clangd/**
 Makefile
 bin/**
 build/**
+build_dir/**
+helper/*.o
+helper/.qtc_clangd/**
+helper/moc*.*
+helper/octphelper
 cachecleaner/bin/**
 cachecleaner/build/**
+cachecleaner/.qtc_clangd/**
 notifier/bin/**
 notifier/build/**
-qrc_resources.cpp
+notifier/.qtc_clangd/**
+notifier/.qtc/**
+notifier/.cmake/**
+notifier/CMakeCache*
+notifier/CMakeFiles*
+notifier/qtcsettings.cmake
 octopi.pro.user
+qrc_resources.cpp
+repoeditor/.qtc_clangd/**
+repoeditor/bin/**
+repoeditor/build/**
+sudo/*.o
+sudo/moc*.*
+sudo/octopi-sudo
+sudo/qrc*.cpp
+sudo/ui_pass*.h
+sudo/.qtc_clangd

.tx/config

@@ -1,8 +1,11 @@
 [main]
 host = https://www.transifex.com
 
-[octopi.octopi]
-file_filter = resources/translations/octopi_<lang>.ts
-source_file = resources/translations/octopi_en.ts
-source_lang = en
-type = QT
+[o:arnt:p:octopi:r:octopi]
+file_filter            = resources/translations/octopi_<lang>.ts
+source_file            = resources/translations/octopi_en.ts
+source_lang            = en
+type                   = QT
+replace_edited_strings = false
+keep_translations      = false
+

CHANGELOG

@@ -1,4 +1,327 @@
-0.8.0
+0.19 (dev)
+  BugFix: Pressing F11 to maximize bottom panel crashed Octopi if Info tab was selected.
+  BugFix: Octopi crashed after using AUR/KCP tool and clicking on a package anchor 
+    in Output tab.
+  BugFix: Optional deps dialog had a column header named "3" instead of "Repository".
+  BugFix: Some outdated AUR pkgs were not showing on notifier (thanks to urbenlegend).
+  BugFix: There was a method called more than once every time distro news was checked.
+  Add the option to make the whole interface text less condensed.
+  Add the option to show/hide "Repository" and "Download Size" columns in package list.
+  Add Repository field in Info tab.
+  Make "Search for outdated AUR packages" a notifier only option.
+  Enable Check updates and System upgrade tool buttons in AUR mode.
+  Show current version of the packages on Notifier's System Upgrade dialog 
+    (thanks to valchx's code).
+  Added chinese description for the application name in desktop file.
+  Updated translations.
+
+0.18.1 (2025-09-29)
+  BugFix: French translation was not working properly (thanks to roxfr).
+  BugFix: Yay searches with version 12.5.2 crashed Octopi (thanks to nije-to-sve).
+  BugFix: Search for BASH also in "/bin".
+  BugFix: Force use of BASH shell was not working (thanks to UnsaltedScholar).
+  BugFix: List of outdated KCP packages was not working in KaOS.
+  BugFix: Under some conditions Octopi could crash due to shared memory access failures.
+  Updated translations.
+
+0.18.0 (2025-09-20)
+  BugFix: The act of moving the mouse over the package list was triggering many
+    "pacman -Si" executions (thanks to RAZUMNO).
+  BugFix: Notifier did not fetch updates for the first time when using "once a day".
+  BugFix: qt-sudo now respects user locale settings (thanks to D10RUS).
+  BugFix: Use better way to detect if user is running the tools from the right place.
+  BugFix: Select Help tab when Octopi runs for the first time.
+  BugFix: Make Actions tab visible when a package is selected for insertion/removal.
+  BugFix: Use system theme folder icon in Files tab.
+  BugFix: Package list refresh was not running after a group install/removal.
+  BugFix: ILoveCandy option was not working 100% in parser.
+  Search option selected by the user is saved on close.
+  Added support for garuda-update command when running in Garuda Linux.
+  Added support for a user specified backup shell script that needs to be placed at 
+    "/usr/lib/octopi/pre-system-upgrade.sh" and executes before the system upgrades.
+  Added support for pacman.conf's IgnorePkg option through "Add to Ignored" and 
+    "Remove from Ignored" actions from the context menu in the package list.
+  Added View/Ignored menu option.
+  Added support for Plus and Minus keys to add and remove packages from the system.
+  Added "Get Latest distro news" menu item to the News tab context menu.
+  Added Apply and Cancel buttons also in the Actions tab.
+  Added "Enable package tooltips" option, so users can disable the feature when needed.
+  Added "Force use of BASH shell" option to ensure compatibility when the user 
+    uses another SHELL.
+  Added Tools/pacman-key option to refresh pacman gpg keys.
+  Modernization of Options dialog.
+  Updated translations.
+
+0.17.0 (2025-02-18)
+  BugFix: Code for EndeavourOS news was incomplete (thanks to LegitGreenBoi).
+  BugFix: Help msg for newer packages was wrong because they're not installed.
+  Prefer Bash shell (/usr/bin/bash) when executing package commands.
+  Added "--editmenu" checkbox on Options dialog if you are using Yay tool.
+  Added option to always use the terminal when executing pacman actions.
+  Play a bell sound when the Terminal tab is asking for the user password.
+  Improvement: Let user choose which domain is pinged when checking for internet access 
+    (if ping.archlinux.org is down).
+  Improvement: Show a "Collecting transaction data..." msg before presenting the transaction 
+    dialog, as it can be quite slow on some systems (thanks to Valdir).  
+  Updated translations.
+
+0.16.2 (2024-06-17)
+  BugFix: Increased width of Terminal tab labels on Options dialog.
+  BugFix: Removed a debug msg when octopi was not being executed with "-d".
+  Updated translations.
+
+0.16.1 (2024-06-09)
+  BugFix: Updated some LANG environment variables to C.UTF-8.
+  BugFix: Info/Files tabs were always empty if they were selected at octopi's start.
+  BugFix: Do not install notifier's desktop file in /etc/xdg/autostart.
+  BugFix: Could not remove packages when internet connection was down (thanks to Theluga).
+  Added shortcut key "Ctrl+Shift+U" to upgrade outdated AUR packages.
+  Arrow keys navegation refresh Info and Files tabs again.
+  Updated translations.
+  
+0.16.0 (2024-05-19)
+  BugFix: '--noeditmenu' is deprecated. Use '--editmenu=false' instead (thanks to rbaruccojr).
+  BugFix: Fixed silent error when pacman's database is locked (thanks to  SloppyPuppy).
+  BugFix: Files tab expand all items by default.
+  BugFix: Updated translations.
+  Now using the unified qt-sudo project (https://github.com/aarnt/qt-sudo) for privilege escalation.
+  Default to Qt6 lib build (including qtermwidget6)
+ 
+0.15.0 (2023-09-10)
+  BugFix: Invalidate Info/Files tabs when user is navigating packages using the keyboard.
+  BugFix: Better handle dependencies while staging packages for deletion.
+  BugFix: First yay-bin download now works again.
+  BugFix: Polished navigation on Info tab dependencies
+  BugFix: AUR passwords that contained a "+" char failed to login at aur.archlinux.org.
+  BugFix: When using the pacman backend, call "pacman -Qm" to fetch ALL foreign packages.
+  BugFix: Change install reason did not work with pacman backend.
+  Made the code Qt5/Qt6 compatible.
+  Using "pacman -Fl" to view contents of non installed packages (thanks to Zesko).
+  Added a Terminal tab to options dialog to config its colors and fonts.
+  Octopi-sudo code was synced to match project "lxqt-sudo" version 1.3.0.
+
+0.14.0 (2022-10-05)
+  Added --overwrite="*" checkbox in AUR tab (Tools/Options) when using yay.
+  Octopi-sudo code was synced to match project "lxqt-sudo" version 1.1.0.
+  BugFix: Package search did not work correctly when query string contained a "+" sign.
+  BugFix: Info/Files tab refresh was duplicated.
+  BugFix: Disable (another try) Info/Files tab refresh while typing in Filter/Search 
+    line edit.
+
+0.13.0 (2022-03-30)
+  BugFix: editFile() caused a crash while in Mate desktop. Both "Open PKGBUILD" 
+    and "Show PKGBUILD diff" options were affected.
+  BugFix: removed stylesheet from treeviews. It makes dark themes look better
+    (thanks to buckmelanoma).
+  BugFix: Pressing ENTER over an installed AUR pkg no longer sends it to the 
+    install action treeview. 
+  BugFix: Made Octopi compatible with aurweb 6.x version (view PKGBUILD,
+    diff PKGBUILD, vote, unvote and list voted AUR).
+  Added "Outdated" filter/option on menu "View".
+  Added a "-checkupdates" parameter to Notifier, so users can update the status
+    of an already running Octopi Notifier.
+  Added option to update selected outdated AUR pkgs directly from the main list.
+ 
+0.12.0 (2021-11-06)
+  Added support for pacman 6.0 (thanks to class101)
+  Added support for Paru AUR tool.
+  Added support for opendoas tool (default).
+  Added support for Archcraft OS.
+  Added support for Garuda Linux distro.
+  Added support for Obarun Linux distro.
+  Actions tab shows a counter feedback for inserts (with a plus signal) and 
+    removals (with a minus signal) and does not steal focus anymore.
+  Octopi-sudo code was synced to match project "lxqt-sudo" version 1.0.0.
+  BugFix: Initial database searches are executed after main interface is shown. 
+    This improves UI feedback on older cpus.
+  BugFix: If there was only 1 result in AUR search, the pkg could not enter 
+    the transaction with the right name.
+  BugFix: IgnorePkg pkgs are shown as outdated when using ALPM backend.
+  BugFix: If user went from AUR to normal search with a not found pkg the statusbar
+    counters would become invisible.
+  BugFix: If options dialog was called while both notifier and octopi were running,
+    Updates tab was not shown.
+
+0.11.0 (2021-01-11)
+  Added support for CMake build system (thanks to Tereius).
+  Added support to build multiple foreign packages at once (they are first copied 
+	to the Actions' tree view just like official packages).
+  Added "Open PKGBUILD" option to open the AUR PKGBUILD file in a text editor.
+  Added "Show PKGBUILD diff" option to show the differences between latest and previous
+	PKGBUILD files of the selected AUR package in a text editor.
+  Added "Install Date" at Info tab.
+  Added "Licenses", "Maintainer", "Depends On", "Make Deps", "Last Modified" and "Out-of-date" 
+	fields at Info tab while in AUR mode.
+  Added option to display "Licenses", "Installed Size", "Build Date", "Install Date" and
+	"Install Reason" columns in the package list.
+  Added option to "Change Install Reason" of selected packages (Explicitly <-> As Dependency).
+  Added a faster refresh package list code after checking for updates.
+  Added "Build directory" option in AUR tab on options dialog, so users can change where
+	makepkg builds the source code.
+  Added support for '^' and '$' chars in AUR search
+  Added "Open news in a browser" option on right clicking the News tab.
+  Optional package dependencies are now installed with "--asdeps" parameter.
+  Octopi-sudo code was synced to match project "lxqt-sudo" version 0.16.0.
+  Updated PKGBUILD file following MatMoul's suggestion.
+  Removed unused speedup service.
+  Prevent users from running Octopi, Notifier and Cache Cleaner outside "/usr/bin" dir.
+  BugFix: Disable Info/Files tab refresh while typing in filter/search line edit.
+  BugFix: unset TMPDIR environment variable on every Octo tool startup 
+	(to avoid "octopi-helper[aborted]: Couldn't attach to memory" errors).
+  BugFix: "total download size" showed the value 0 in Notifier if the database was not synched.
+  BugFix: Pressing ESC in repoeditor could ask if you wanted to save your changes even
+	if there were no changes made.
+  BugFix: Running Notifier within a DE session could lead to a "Suspicious execution method" error.
+  BugFix: If you tried to execute octopi after upgrading your system with notifier you got a
+	notifier crash and an octopi freeze (thanks to linuxer for pointing that out).
+  BugFix: Prevent icon changes in notifier when there were transaction errors.
+  BugFix: The list of targets to install were not showing ok in the transaction dialog.
+  BugFix: Restored support for command line parameters like "-sysupgrade-noconfirm" and "-style".
+  BugFix: Updated "-help" output text.
+  BugFix: Tab navigation improvements.
+  BugFix: Statusbar showed a number of packages when the list was empty (the previous value).
+  BugFix: Clicking on printed outdated packages in Output tab did not send to corresponding 
+	package in the main list after a 'Check updates'.
+  BugFix: WM detection now uses "ps -aux".
+
+0.10.0 (2020-07-19)
+  Added a built-in default priviledge escalation tool: "octopi-sudo" as a slightly modified version 
+	of "lxqt-sudo" project (version 0.15.0). It's the only escalation tool supported!
+  Added option to vote/unvote for AUR packages using aur.archlinux.org login.
+  Added "pikaur" AUR tool support (thanks to ewilly).
+  Added "yay" AUR tool support.
+  Added option "--devel" in AUR tab to check for newer versions of dev packages.
+  Added option to download a temporary yay-bin to enable AUR.
+  Updated some UI icons and added an specific one for foreign non installed pkg.
+  Dropped support for external terminal applications. QTermWidget is mandatory now!
+  Print ".pacnew" file list summary after upgrade (if any).
+  Added Lumina desktop support.
+  RepoEditor now saves window size and position.
+  Added "copy" command to octopi's embedded terminal context menu.
+  Added option to enable/disable confirmation dialog in system upgrade.
+  Added option to enable/disable internet checking.
+  Renamed Transaction tab to Actions tab.
+  Added left click support on package icon in package list to launch context menu.
+  Added option to never check for package updates in Notifier.
+  Added tooltip "Upgrading..." while Notifier is upgrading the system.
+  Added "Info" option in package list context menu.
+  Added ArcoLinux, Artix Linux, CondresOS and EndeavourOS distro support.
+  Added support for sudo (and NOPASSWD) executing thru new octopi-helper subproject.
+  Added option to exit Octopi while a transaction is already running.
+  Added support for GNOME file manager/editor.
+  Added option for changing use of alternating row colors in package list.
+  Added a redesigned AUR tab in Options dialog.
+  Added option to change terminal's color scheme, font family and font size through ~/.config/octopi/octopi.conf.
+  Maximization of properties pane now hides tab bar.
+  BugFix: Many clazy/manual code enhancements merged from luis-pereira (from LXQt organization).
+  BugFix: AUR upgrades in notifier were not setting m_commandExecuting flag.
+  BugFix: Make notifier code consistent with AUR upgrades.
+  BugFix: Replaced 'Sync database' command text to 'Check updates'.
+  BugFix: Always do a "pacman -Syu" in System Upgrade.
+  BugFix: Notifier now uses "checkupdates" instead "pacman -Sy[y]". This means Octopi no longer can lead 
+	the OS to a "partial updates" state and works gracefully with other package tools.
+  BugFix: Don't let user exits RepoEditor without answerig if he wants to save changes.
+  BugFix: Sometimes non-outdated AUR packages did not get refreshed.
+  BugFix: Now Actions tab is disable while in AUR mode.
+  BugFix: Make "Open terminal here" option work with qtermwidget.
+  BugFix: Added support for symbolic lynks in "open file".
+  BugFix: Pkg build date obeys Locale datetime format.
+  BugFix: SysInfo no longer pushes the collected logs to a remote paste service. It saves them locally.
+  BugFix: "exists in filesystem" messages during transactions are shown again.
+  BugFix: MultiselectionDialog did not resize pkg description automatically.
+  BugFix: Some packages were not displaying Optional Deps at Info tab.
+  BugFix: Huge delay when scrolling thru large package list.
+  BugFix: Speed improvements in package list building.
+  BugFix: OptionsDialog was not saving AUR settings if tab changed before clicking OK.
+  BugFix: Changed Manjaro news url.
+  BugFix: Notifier checked for available internet connection too early with an error dialog box.
+  BugFix: Changed command string to Reinstall/Update when package is already installed or outdated.
+  BugFix: Clear filter line edit when navigating thru package anchors at Info tab.
+  BugFix: Info and Files tabs were not showing any info automaticaly when switching between 
+	foreign tool/pacman lists.
+  BugFix: Enable a more complete UI lockdown during transactions.
+  BugFix: Enable "Find a file" context menu option on a non installed pkg.
+
+0.9.0 (2018-06-08)
+  Parser changes: added counter for processed packages.  
+  Group pane now spans all window's height.
+  SysInfo now uses ptpb site and does not block interface.
+  Added Trizen (AUR tool) support.
+  Added Terminal tab if user compiles project with libqtermwidget5 support.
+  Added Terminal dialog in Notifier (AUR update) if user compiles project with 
+	libqtermwidget5 support.
+  Added an Options dialog to Octopi and Notifier.
+  Added button after progressbar to stop current running transaction.
+  Added configurable "--noconfirm" and "--noedit" options to pacaur and "--noconfirm" to yaourt.
+  Added "Search/Use Instant Search" toggle.
+  Added slovenian translation (thanks to the translation crew).
+  Added support fo drag pacman packages to Octopi's mainwindow so they can be installed.
+  Added "Install Reason" field at Info tab.
+  Added support for ALPM utils lib (thanks to guinux, from Pamac project). So, now it's possible to 
+	show "Download Size" in package list.
+  Added link support in all Info tab package lists.
+  Added option to upgrade outdated foreign packages from Octopi Notifier.
+  Added Hindi translation (thanks to Panwar108).
+  Name of AUR package in Info tab act as link to its site at https://aur.archlinux.org.
+  Search line edit is always focused when the program starts.
+  Prevent user to install partial upgrades in his system (ex: only some of the outdated packages).
+  Do NOT clear search string when switching between AUR/pacman.
+  BugFix: If threre are updated News after a synchronization, let's goto the News Tab.
+  BugFix: Remove only Octopi tools related temporary files (qtsingleapp*).
+  BugFix: Do not let program display an avalanche of internet related errors.
+  BugFix: Exec internet tests before some commands in Octopi and Notifier.
+  BugFix: Parser was not outputing repository errors when syncinc.
+  BugFix: repoeditor now runs as normal user and asks for root password on save.
+  BugFix: If Notifier hid Octopi and was closed, Octopi's window would stay hidden.
+  BugFix: Notifier's about dialog was never screen centered.
+  BugFix: When no AUR helper exists, the group of packages panel stayed disabled.
+  BugFix: Cache Cleaner now saves its window geometry.
+  BugFix: Infinite wait cursor in Cache Cleaner when user press Enter for more than two
+	seconds in the spin boxes.
+  BugFix: Some pkg download/installed sizes were not showing properly at Info tab.
+  BugFix: If we find an outdated AUR pkg in the official pkg list, we remove it.
+  BugFix: Install local packages did not work with space separated paths 
+	(thanks to voanhcuoc for pointing it out).
+  BugFix: About and System Upgrade dialogs could be opened twice in notifier.
+  BugFix: Max time in minutes for notification interval was not honoring > 1380.
+  BugFix: Optional dependencies dialog can now be resized and new value is 
+	persisted on disk.
+  BugFix: Using the alpm algorithm for package version comparison. Previous code 
+	was reporting false newer packages.
+  BugFix: System upgrade button was not disabled while synching packages in notifier.
+  BugFix: searchlineedit font fix.
+  BugFix: 'yaourt' and 'pacaur' no longer honor "-a" option when querying outdated 
+	foreign packages.
+  BugFix: System upgrade shortcut changed to "ctrl+P" as "ctrl+U" is used to cut text in 
+	QLineEdit widgets.
+  BugFix: When user selected another search option, line edit was not being cleared.
+  BugFix: Disable alien icon while in transaction.
+  BugFix: Do not ask twice for password if a pacman lck file exists.
+
+0.8.1 (2016-03-27)
+  BugFix: Updated CHAKRA RSS site (thanks to s8321414).
+  BugFix: Distro news now works with https KaOS site.
+  BugFix: Files tab was not refreshing when enabling KCP mode in KaOS.
+  BugFix: Do not permit two or more octopi instances if one is in root mode.
+  BugFix: When there's a pkg change outside Octopi, we trigger a flag to refresh the lists.
+  BugFix: When you were searching for a pkg and the Files tab was selected, focus got lost.
+  BugFix: Package dependencies with >, <, =, >= and <= signals were not clickable in Info tab.
+  BugFix: When user commits a transaction, commit and cancel buttons must get disabled.
+  Package list now also preserves sort column and sort order while in AUR/KCP/CCR mode.
+  Make Octopi more keyboard friendly.
+  Pressing <ENTER>, <RETURN> and <DELETE> keys on package list triggers package actions.
+  Stop using 'notify-send' in octopi-notifier: the era of annoying notifiers is over.
+  Major refactoring: Decoupling of Pacman executor and parser code from the UI as well as 
+	SearchBar slots for QTextBrowser objects.
+  Added URL information to yaourt/pacaur remote pkgs at Info tab.
+  Added <F2> shortcut to focus package list.
+  Added an output dialog to notifier, so users can do a system upgrade without a terminal.
+  Added an entry for Mirror-check in Tools menu.
+  Added support for Simplified Chinese (zh_CN).
+  Added support for lxqt-sudo tool (thanks to Manjaro team).
+  Added "pkgfile -u" (if available) in sync db transaction.
+
+0.8.0 (2015-11-08)
   This is a Qt5 only version (with the exception of 'octopi-notifier').
   BugFix: Speed optimizations in startup code (AUR outdated list).
   BugFix: Octopi now honors the $SHELL variable (thanks to LAC1213).
@@ -18,7 +341,7 @@
   BugFix: Added option to search files with "\+" (escaping the  plus sign). This would find things such 
 	as C++ => "c\+\+" (thanks to maxis11).
   Added support to "kcp --information" at Info tab.
-  Now tab Files shows a progressbar while building the list of files.
+  Now Files tab shows a progressbar while building the list of files.
   Yellow notifier icon tooltip now displays Foreign repo tool name.  
   When outdated packages are printed at Output tab, you can see their 
 	information just hovering the mouse over them.
@@ -29,7 +352,7 @@
   Help/About dialog now shows Pacman information.
   StatusBar msg got updated with number of selected packages more visible.  
 
-0.7.0
+0.7.0 (2015-04-27)
   Major speed fix: Faster pkg list building.
   Reverted to showing ALL packages at startup.
   Added a systemd service to speed up the very first octopi startup time.
@@ -59,7 +382,7 @@
   BugFix: If user had no gksu/kdesu/root when clicking "clean" button in 
 	cachecleaner, cursor would remain waiting (thanks to imperator-).
 
-0.6.0
+0.6.0 (2015-02-27)
   BugFix: Pkg list was being refreshed twice sometimes.
   BugFix: Removed some buggy strings from Output tab while in KF5.
   BugFix: ArrowUp/Down, PageUp/Down and Home/End keys now refresh Package Info tab.
@@ -87,7 +410,7 @@
   Refactorings in SearchLineEdit.
   BugFixes in RepoEditor translation support (repoeditor is now in Transifex too).
 
-0.5.0
+0.5.0 (2014-11-08)
   BugFix: RepoEditor would not compile with Qt5 lib (thanks to Philm).
   BugFix: Suppress GConf error strings in output.
   BugFix: mate-terminal is returning code 255 even when execution of 
@@ -113,14 +436,14 @@
   Added support for KStatusNotifier while in KDE (thanks to brcha).
   Updated translations.
 
-0.4.2
+0.4.2 (2014-07-26)
   BugFix: when searching AUR pkgs, given search string was not being matched 
 	by package descriptions.
   BugFix: Sometimes got a gconf bug string at sync db.
   Updated a bunch of translations.
   Added support for the new kcp tool (Go version).
 
-0.4.1
+0.4.1 (2014-07-12)
   Added basque translation (thanks to tarteka).
   Added es_AR translation (thanks to javier).
   Added japanese translation (thanks to UTUMI Hirosi - utuhiro78).
@@ -134,7 +457,7 @@
   BugFix: Adapted ArchBang changes.
   BugFix: Removed unused Ctrl+N help text.
   BugFix: Some changes in LXQt support.
-  BugFix: Download and installed size info at info tab.
+  BugFix: Download and installed size info at Info tab.
   BugFix: The 'Enter' key (numeric keyboard) is now supported.
   BugFix: At start when there is no pacman db, octopi hangs (thanks to anex).
   BugFix: After a pkg list rebuild the Files and Info cache were not 
@@ -148,7 +471,7 @@
   Added Search by file feature (pacman -Qo).
   Added a string validator in the search edit widget.
 
-0.4.0
+0.4.0 (2014-05-24)
   Huge refactorings in model/view that brings consistent memory and 
 	speed improvements - a single model and a central data storage (thanks to 
 	Thomas Binkau - tbinkau).
@@ -202,7 +525,7 @@
   Fixed getBuildDate code to always convert dates to english format.
   Updated some translations.
 
-0.3.2
+0.3.2 (2014-02-14)
   Cleaned unused code.
   Added icon for mirror-check while in KaOS.
   Does a mirror-check at startup while in KaOS.
@@ -217,7 +540,7 @@
   BugFix: When the user had no yaourt in the system, there were a zombie 
 	octopi process 'left running'.
 
-0.3.1
+0.3.1 (2014-01-14)
   Added support for Qt5.
   Added chinese (Taiwan), malay, slovak and ukrainian translations.
   Added support to KaOS, a lean KDE centric Linux distro.
@@ -228,7 +551,7 @@
 	first searches into transaction queue for them.
   BugFix: Prevent header resizing in File and Transaction tabs.
 
-0.3
+0.3.0 (2013-11-03) 
   Code cleanings.
   BugFix: No need to refresh package list after a cache clean.
   BugFix: Konsole was not working with yaourt package installation.
@@ -275,7 +598,7 @@
   Added an About Dialog to Octopi Notifier.
   Updated translations.
 
-0.2
+0.2.0 (2013-08-24)
   Splitted the project in "octopi" and "octopi-notifier".
   Yaourt no longer runs with root permissions.
   Added support for package multi selection in Yaourt mode.
@@ -296,23 +619,23 @@
   IgnorePkg option is now used to build outdated package list.
   BugFix: Empty pkg descriptions are now shown as empty.
 
-0.1.9.1
+0.1.9.1 (2013-07-14)
   Important bugfixes to deal with multithreaded code.
   Added a "globals.h/.cpp" file to group QFutureWatcher globals.
   Updated style changing code in main.cpp.
   BugFix: when user cancelled a sysupgrade transaction inside a 
 terminal, the package actions remained disabled.
 
-0.1.9
+0.1.9 (2013-07-09)
   Added yaourt support.
   Updated most of the translations.
 
-0.1.8
+0.1.8 (2013-06-16)
   Added czech translation.
   Added support to ArchBang Linux.
   Added a systemtray icon notifier feature using DBus technology.
 
-0.1.7.3
+0.1.7.3 (2013-05-26)
   Added a TRANSLATIONS file.
   Added danish translation.
   Added indonesian translation.
@@ -322,14 +645,14 @@ terminal, the package actions remained disabled.
   Bugfix: sysupgrade must refresh packagelist after syncdatabase.
   Bugfix: if sysupgrade uses SyncFirst, makes it automatically start a second upgrade.
 
-0.1.7.2
+0.1.7.2 (2013-05-17)
   Added catalan translation.
   Bugfix: updated new binary translation files to the resources.
 
-0.1.7.1
+0.1.7.1 (2013-05-11)
   Bugfix: menu icons were not being shown while in Xfce.
 
-0.1.7
+0.1.7 (2013-05-11)
   Added "-sysupgrade" command line option.
   Added "-removecmd" command line option.
   Added lots of translations.
@@ -337,11 +660,11 @@ terminal, the package actions remained disabled.
   Added an About dialog.
   Changed the old About tab to Usage tab.
 
-0.1.6.1
+0.1.6.1 (2013-04-25)
   Added pt_BR translation.
   Added "Open root terminal" option in File menu.
 
-0.1.6
+0.1.6 (2013-04-12)
   Added a new Transaction Dialog.
   Added a Firefox-like search inside Files, News and About tabs.
   Added support for Chakra.
@@ -349,33 +672,33 @@ terminal, the package actions remained disabled.
   Added option to execute any transaction inside a terminal.
   Changed ProgressDialog to a progressBar at the screen bottom.
   
-0.1.5
+0.1.5 (2013-04-06)
   Added option to search packages by description and name.
   Added support for pacman version 4.1.
   Transactions with conflict errors can be re-executed inside a terminal.
   Reworked Manjaro Linux theme.
 
-0.1.4.1
+0.1.4.1 (2013-03-30)
   Bugfix release
   Added total download size information in transaction dialog.
 
-0.1.4
+0.1.4 (2013-03-28)
   Added a Manjaro Linux theme.
   Changed position of filter line edit to the toolbar.
 
-0.1.3
+0.1.3 (2013-03-19)
   Added better support to Qt dark themes.
   Added context menu support inside Files tab.
-  Made URLs clickable inside output tab.
+  Made URLs clickable inside Output tab.
   Fixed the annoying Packager information display bug.
 
-0.1.2
+0.1.2 (2013-03-18)
   Tons of refactorings and bugfixes.
   Small changes in UI.
 
-0.1.1 
+0.1.1 (2013-03-17)
   Added all six tabs.
   Added support for groups of packages.
 
-0.1.0 
+0.1.0 (2013-03-11)
   Initial Proof of Concept release.

CMakeLists.txt

@@ -0,0 +1,130 @@
+cmake_minimum_required(VERSION 3.5)
+project(octopi VERSION 0.19.0 LANGUAGES CXX)
+
+set(CMAKE_CXX_STANDARD 17)
+set(CMAKE_CXX_STANDARD_REQUIRED ON)
+set(CMAKE_THREAD_PREFER_PTHREAD True)
+set(CMAKE_RUNTIME_OUTPUT_DIRECTORY "${CMAKE_CURRENT_BINARY_DIR}")
+
+option(USE_QTERMWIDGET6 "Build with qtermwidget6 instead of qtermwidget5" ON)
+
+add_subdirectory(helper)
+add_subdirectory(notifier)
+add_subdirectory(cachecleaner)
+add_subdirectory(repoeditor)
+
+if (USE_QTERMWIDGET6)
+  find_package(Qt6 REQUIRED COMPONENTS Core Core5Compat Gui Network Xml Widgets LinguistTools Multimedia)
+  find_package(qtermwidget6 REQUIRED)
+else()
+  find_package(Qt5 REQUIRED COMPONENTS Core Gui Network Xml Widgets LinguistTools Multimedia)
+  find_package(qtermwidget5 REQUIRED)
+endif()
+
+find_package(alpm_octopi_utils REQUIRED)
+
+set(CMAKE_AUTOMOC ON)
+
+file(GLOB TS_FILES LIST_DIRECTORIES false "${CMAKE_CURRENT_LIST_DIR}/resources/translations/*.ts")
+qt_add_translation(qmFiles ${TS_FILES})
+
+set(src
+    src/QtSolutions/qtsingleapplication.cpp
+    src/QtSolutions/qtlocalpeer.cpp
+    repoeditor/repoentry.cpp
+    src/aurvote.cpp
+    src/propertiestabwidget.cpp
+    src/qaesencryption.cpp
+    src/repoconf.cpp
+    src/main.cpp
+    src/mainwindow.cpp
+    src/strconstants.cpp
+    src/searchlineedit.cpp
+    src/argumentlist.cpp
+    src/settingsmanager.cpp
+    src/package.cpp
+    src/unixcommand.cpp
+    src/wmhelper.cpp
+    src/treeviewpackagesitemdelegate.cpp
+    src/mainwindow_init.cpp
+    src/mainwindow_transaction.cpp
+    src/mainwindow_events.cpp
+    src/mainwindow_help.cpp
+    src/searchbar.cpp
+    src/mainwindow_searchbar.cpp
+    src/transactiondialog.cpp
+    src/mainwindow_news.cpp
+    src/mainwindow_refresh.cpp
+    src/globals.cpp
+    src/multiselectiondialog.cpp
+    src/packagerepository.cpp
+    src/model/packagemodel.cpp
+    src/ui/octopitabinfo.cpp
+    src/utils.cpp
+    src/terminal.cpp
+    src/pacmanexec.cpp
+    src/optionsdialog.cpp
+    src/packagetreeview.cpp
+    src/termwidget.cpp
+    src/alpmbackend.cpp)
+
+set(header
+    src/QtSolutions/qtsingleapplication.h
+    src/QtSolutions/qtlocalpeer.h
+    repoeditor/repoentry.h
+    src/aurvote.h
+    src/propertiestabwidget.h
+    src/qaesencryption.h
+    src/repoconf.h
+    src/mainwindow.h
+    src/strconstants.h
+    src/searchlineedit.h
+    src/argumentlist.h
+    src/settingsmanager.h
+    src/uihelper.h
+    src/package.h
+    src/unixcommand.h
+    src/wmhelper.h
+    src/treeviewpackagesitemdelegate.h
+    src/searchbar.h
+    src/transactiondialog.h
+    src/globals.h
+    src/multiselectiondialog.h
+    src/packagerepository.h
+    src/model/packagemodel.h
+    src/ui/octopitabinfo.h
+    src/utils.h
+    src/terminal.h
+    src/pacmanexec.h
+    src/constants.h
+    src/optionsdialog.h
+    src/packagetreeview.h
+    src/termwidget.h
+    src/alpmbackend.h)
+
+set(ui ui/mainwindow.ui ui/transactiondialog.ui ui/multiselectiondialog.ui ui/optionsdialog.ui)
+
+set(qrc resources.qrc)
+
+qt_wrap_ui(src ${ui})
+qt_add_resources(src ${qrc})
+
+add_executable(octopi ${src} ${header} ${qmFiles})
+target_compile_definitions(octopi PRIVATE OCTOPI_EXTENSIONS ALPM_BACKEND QT_DEPRECATED_WARNINGS QT_USE_QSTRINGBUILDER QT_NO_CAST_FROM_ASCII QT_NO_CAST_TO_ASCII QT_NO_URL_CAST_FROM_STRING QT_NO_CAST_FROM_BYTEARRAY)
+
+if (USE_QTERMWIDGET6)
+  target_include_directories(octopi PRIVATE ${CMAKE_CURRENT_SOURCE_DIR} ${CMAKE_CURRENT_BINARY_DIR} ${Qt6Core_INCLUDE_DIRS} ${Qt6Gui_INCLUDE_DIRS} ${Qt6Network_INCLUDE_DIRS} ${Qt6Xml_INCLUDE_DIRS} ${Qt6Widgets_INCLUDE_DIRS})
+  target_link_libraries(octopi PRIVATE Qt6::Core Qt6::Gui Qt6::Network Qt6::Xml Qt6::Widgets Qt6::Multimedia qtermwidget6 alpm_octopi_utils)
+else()
+  target_include_directories(octopi PRIVATE ${CMAKE_CURRENT_SOURCE_DIR} ${CMAKE_CURRENT_BINARY_DIR} ${Qt5Core_INCLUDE_DIRS} ${Qt5Gui_INCLUDE_DIRS} ${Qt5Network_INCLUDE_DIRS} ${Qt5Xml_INCLUDE_DIRS} ${Qt5Widgets_INCLUDE_DIRS})
+  target_link_libraries(octopi PRIVATE Qt5::Core Qt5::Gui Qt5::Network Qt5::Xml Qt5::Widgets Qt5::Multimedia qtermwidget5 alpm_octopi_utils)
+endif()
+
+file(COPY "${CMAKE_CURRENT_SOURCE_DIR}/resources/images/octopi_green.png" DESTINATION "${CMAKE_CURRENT_BINARY_DIR}")
+file(RENAME "${CMAKE_CURRENT_BINARY_DIR}/octopi_green.png" "${CMAKE_CURRENT_BINARY_DIR}/octopi.png")
+install(TARGETS octopi RUNTIME DESTINATION bin LIBRARY DESTINATION lib PUBLIC_HEADER DESTINATION include)
+install(FILES "${CMAKE_CURRENT_SOURCE_DIR}/octopi.desktop" DESTINATION share/applications)
+install(FILES "${CMAKE_CURRENT_BINARY_DIR}/octopi.png" "${CMAKE_CURRENT_SOURCE_DIR}/resources/images/octopi_green.png" DESTINATION share/icons/hicolor/48x48/apps)
+install(FILES "${CMAKE_CURRENT_BINARY_DIR}/octopi.png" "${CMAKE_CURRENT_SOURCE_DIR}/resources/images/octopi_green.png"
+        "${CMAKE_CURRENT_SOURCE_DIR}/resources/images/octopi_red.png" "${CMAKE_CURRENT_SOURCE_DIR}/resources/images/octopi_yellow.png" DESTINATION share/icons/hicolor/48x48/apps)
+install(FILES "${CMAKE_CURRENT_SOURCE_DIR}/LICENSE" DESTINATION share/licenses/octopi)

INSTALL

@@ -1,6 +1,6 @@
 Installing Octopi is a pretty straightforward task. 
 
-Assuming you have updated Qt4(*) libs installed in your system, all 
+Assuming you have updated Qt5 libs installed in your system, all
 you have to do is run:
 
 	makepkg -f
@@ -8,21 +8,10 @@ you have to do is run:
 Wait for the compilation and then install the generated package (as 
 root), using:
 
-	pacman -U [--force] <nameOfTheGeneratedOctopiPackage.tar.xz>
+        pacman -U <nameOfTheGeneratedOctopiPackage.tar.[xz|zst]>
 
-You can also install the generated package notifier, using:
-
-	pacman -U [--force] <nameOfTheGeneratedOctopiNotifierPackage.tar.xz>
-
-Octopi is located at the system utilities menu of your Desktop 
+Octopi is located on the system utilities menu of your Desktop
 Environment.
 
 
 Enjoy!
-
-(*) Octopi is also Qt5 compatible, you'll only have to adjust the 
-"depends" section in PKGBUILD.
-
-If you are compiling Octopi in a KDE centric-distro like KaOS and Chakra, you should 
-first uncomment the "#define NO_GTK_STYLE" string located at "src/main.cpp" and 
-"notifier/octopi-notifier/main.cpp", otherwise it won't compile at all.

PKGBUILD

@@ -1,107 +1,53 @@
-pkgname=('octopi' 'octopi-notifier' 'octopi-repoeditor' 'octopi-cachecleaner')
-pkgver=0.8.0
+_pkgname=octopi
+pkgname=octopi-git
+pkgver=0.19.0.latest
 pkgrel=1
-pkgdesc="a powerful Pacman frontend using Qt libs"
+pkgdesc="This is Octopi, a powerful Pacman frontend using Qt libs (git checkout)"
+url="https://tintaescura.com/projects/octopi/"
 arch=('i686' 'x86_64')
-url="http://octopiproject.wordpress.com"
 license=('GPL2')
-install=$pkgname.install
+depends=('alpm_octopi_utils' 'qtermwidget' 'sudo')
 makedepends=('git')
-depends=('qt4' 'qt5-quickcontrols' 'xterm')
-optdepends=('kdesu: for KDE'
-            'gksu: for XFCE, Gnome, LXDE, Cinnamon'
-            'gnome-keyring: for password management'
-            'gist: for SysInfo report'
-	    'yaourt: for AUR support'
-            'octopi-notifier: for notifications'
-            'pkgfile: to view uninstalled pkg contents in ArchLinux')
-provides=('octopi')
-md5sums=()
+groups=('system')
+source=("git+https://github.com/aarnt/octopi.git")
+md5sums=('SKIP')
+
+prepare() {
+   cd "${_pkgname}"
+   cp resources/images/octopi_green.png resources/images/octopi.png
+}
+
+#pkgver() {
+#   cd "${_pkgname}"
+#   git describe --long --tags --abbrev=7 | sed 's/\([^-]*-g\)/r\1/;s/-/./g;s/^v//'
+#}
 
 build() {
-    cpucount=$(grep -c processor /proc/cpuinfo 2>/dev/null)
-    jc=$((${cpucount:-1}))
+   cd "${_pkgname}"
+   echo "Starting build..."   
+   qmake6 PREFIX=/usr QMAKE_CFLAGS="${CFLAGS}" QMAKE_CXXFLAGS="${CXXFLAGS}" QMAKE_LFLAGS="${LDFLAGS}" octopi.pro
+   make
 
-    #cd "$srcdir"  
-    msg "Starting build..."
-
-    cd $startdir
-    qmake-qt5 $pkgname.pro 	
-    make -j $jc
-
-    cd $startdir/notifier/pacmanhelper
-    msg "Building pacmanhelper..."
-    qmake-qt5 pacmanhelper.pro
-    make -j $jc    
-    
-    cd $startdir/notifier/octopi-notifier
-    msg "Building octopi-notifier..."
-    qmake-qt4 octopi-notifier.pro
-    make -j $jc
-
-    cd $startdir/repoeditor
-    msg "Building octopi-repoeditor..."
-    qmake-qt5 octopi-repoeditor.pro
-    make -j $jc
-
-    cd $startdir/cachecleaner
-    msg "Building octopi-cachecleaner..."
-    qmake-qt5 octopi-cachecleaner.pro
-    make -j $jc
+   _subdirs="cachecleaner helper notifier repoeditor"
 
+   for _subdir in $_subdirs; do
+     pushd $_subdir
+     echo "Building octopi-$_subdir..."
+     qmake6 PREFIX=/usr QMAKE_CFLAGS="${CFLAGS}" QMAKE_CXXFLAGS="${CXXFLAGS}" QMAKE_LFLAGS="${LDFLAGS}" "octopi-$_subdir.pro"
+     make
+     popd
+   done  
 }
 
-package_octopi() {   
-   #Octopi main files
-   install -D -m755 $startdir/bin/$pkgname ${pkgdir}/usr/bin/$pkgname
-   install -D -m644 $startdir/$pkgname.desktop ${pkgdir}/usr/share/applications/$pkgname.desktop
-   install -D -m644 $startdir/resources/images/${pkgname}_green.png ${pkgdir}/usr/share/icons/$pkgname.png
-   install -D -m644 $startdir/resources/images/${pkgname}_green.png ${pkgdir}/usr/share/icons/gnome/32x32/apps/$pkgname.png
-   install -D -m644 $startdir/resources/images/${pkgname}_red.png ${pkgdir}/usr/share/icons/${pkgname}_red.png
-   install -D -m644 $startdir/resources/images/${pkgname}_yellow.png ${pkgdir}/usr/share/icons/${pkgname}_yellow.png
+package() {
+   cd "${_pkgname}"
+   make INSTALL_ROOT="${pkgdir}" install
 
-   #speedup files
-   install -D -m755 $startdir/speedup/speedup-octopi.sh ${pkgdir}/usr/bin/speedup-octopi.sh
-   install -D -m644 $startdir/speedup/${pkgname}.service ${pkgdir}/etc/systemd/system/${pkgname}.service
+   _subdirs="cachecleaner helper notifier repoeditor"
 
-   #Pacmaneditor files
-   install -D -m755 $startdir/repoeditor/bin/octopi-repoeditor ${pkgdir}/usr/bin/octopi-repoeditor
-
-   #Cachecleaner files
-   install -D -m755 $startdir/cachecleaner/bin/octopi-cachecleaner ${pkgdir}/usr/bin/octopi-cachecleaner
-   install -D -m644 $startdir/cachecleaner/octopi-cachecleaner.desktop ${pkgdir}/usr/share/applications/octopi-cachecleaner.desktop
-}
-
-package_octopi-notifier() {
-   pkgdesc="Notifier for Octopi"
-   depends=('libnotify')
-   optdepends=('octopi: launch graphical package manager from tray'
-               'xfce4-notifyd: for notifications in XFCE')
-
-   #Pacmanhelper service files
-   install -D -m755 $startdir/notifier/bin/pacmanhelper ${pkgdir}/usr/lib/octopi/pacmanhelper
-
-   install -D -m644 $startdir/notifier/pacmanhelper/polkit/org.octopi.pacman.policy ${pkgdir}/usr/share/polkit-1/actions/org.octopi.pacman.policy
-   install -D -m644 $startdir/notifier/pacmanhelper/polkit/org.octopi.pacmanhelper.conf ${pkgdir}/etc/dbus-1/system.d/org.octopi.pacmanhelper.conf
-   install -D -m644 $startdir/notifier/pacmanhelper/polkit/org.octopi.pacmanhelper.xml ${pkgdir}/usr/share/dbus-1/interfaces/org.octopi.pacmanhelper.xml
-   install -D -m644 $startdir/notifier/pacmanhelper/polkit/org.octopi.pacmanhelper.service ${pkgdir}/usr/share/dbus-1/system-services/org.octopi.pacmanhelper.service
-
-   #Octopi-notifier file
-   install -D -m755 $startdir/notifier/bin/octopi-notifier ${pkgdir}/usr/bin/octopi-notifier
-   install -D -m644 $startdir/octopi-notifier.desktop ${pkgdir}/etc/xdg/autostart/octopi-notifier.desktop
-}
-
-package_octopi-repoeditor() {
-   pkgdesc="Repoeditor for Octopi"
-   
-   #Octopi-repoeditor file
-   install -D -m755 $startdir/repoeditor/bin/octopi-repoeditor ${pkgdir}/usr/bin/octopi-repoeditor
-}
-
-package_octopi-cachecleaner() {
-   pkgdesc="Cachecleaner for Octopi"
-
-   #Octopi-cachecleaner file
-   install -D -m755 $startdir/cachecleaner/bin/octopi-cachecleaner ${pkgdir}/usr/bin/octopi-cachecleaner
-   install -D -m644 $startdir/cachecleaner/$pkgname.desktop ${pkgdir}/usr/share/applications/$pkgname.desktop
+   for _subdir in $_subdirs; do
+     pushd $_subdir
+     make INSTALL_ROOT="${pkgdir}" install
+     popd
+   done   
 }

README.md

@@ -1,59 +1,147 @@
-## This is Octopi, a powerful Pacman/AUR frontend using Qt libs.
+## This is Octopi, a powerful Pacman/AUR front end using Qt libs.
 
-The project site is hosted at https://octopiproject.wordpress.com
+![Main window](https://raw.githubusercontent.com/aarnt/octopi/master/octopi-mainwindow.png)
+![Options dialog](https://raw.githubusercontent.com/aarnt/octopi/master/octopi-optionsdialog.png)
+![Main window with qss](https://raw.githubusercontent.com/aarnt/octopi/master/octopi-mainwindow-with-qss.png)
 
-Currently, 10 Linux distros are compatible with it
+The project site is hosted on https://tintaescura.com/projects/octopi
 
- * [Antergos] (https://antergos.com/)
- * [ArchBang] (http://wiki.archbang.org/index.php?title=Main_Page)
- * [Arch] (https://www.archlinux.org/)
- * [ArchBSD] (https://pacbsd.org/)
- * [Chakra] (https://chakraos.org/)
- * [KaOS] (http://kaosx.us/)
- * [Manjaro] (http://manjaro.github.io/)
- * [mooOS] (http://mooos.org/)
- * [Netrunner (rolling)] 
-(http://www.netrunner.com/netrunner-rolling-release/)
- * [Parabola GNU/Linux-libre] (http://www.parabola.nu/https/)
+Currently, 11 Linux distros are compatible with it
 
-### What you must install in your system to have Octopi fully functional
+ * [ArchBang](http://archbang.org/)
+ * [Archcraft](https://archcraft.io/)
+ * [Arch Linux](https://www.archlinux.org/)
+ * [ArcoLinux](https://arcolinux.info/)
+ * [Artix Linux](https://artixlinux.org)
+ * [CachyOS](https://cachyos.org/)
+ * [EndeavourOS](https://endeavouros.com/)
+ * [Garuda Linux](https://garudalinux.org/)
+ * [KaOS](https://kaosx.us/)
+ * [Manjaro](https://manjaro.org/)
+ * [Obarun Linux](https://web.obarun.org/index.php?id=1)
 
-You'll need a privilege escalation tool to use it, once running as
-root will ONLY work in KDE. Octopi supports kdesu and gksu for that.
+### What you must install in order to have Octopi fully functional
 
-### Simple steps to build Octopi code
+You'll need:
+ * [Alpm_octopi_utils](https://github.com/aarnt/alpm_octopi_utils/) library
+ * A helper to execute pacman commands called "octphelper", available on "./helper" dir
+ * A privilege escalation tool called [qt-sudo](https://github.com/aarnt/qt-sudo/)
+ * qtermwidget package, in order to build Octopi with embedded terminal support
 
-Assuming you have Qt5 libs properly installed, go to the directory that has the code:
+### To install Octopi using pacman
+
+If Octopi package is available in your distro's repository, you can just type:
 
 ```
-$ cd OCTOPI_PATH
-$ qmake
+# pacman -S octopi
+```
+
+### Steps to build Octopi source code (qmake)
+
+Assuming you have vala compiler and Qt6 libs properly installed, follow these steps:
+
+```
+$ git clone https://github.com/aarnt/alpm_octopi_utils
+$ cd alpm_octopi_utils
 $ make
+# make install
+$ cd ..
+$ git clone https://github.com/aarnt/qt-sudo
+$ cd qt-sudo
+$ qmake6
+$ make
+# make install
+$ cd ..
+$ git clone https://github.com/aarnt/octopi
+$ cd octopi/helper
+$ qmake6
+$ make
+# make install
+$ cd ../notifier
+$ qmake6
+$ make
+# make install
+$ cd ../cachecleaner
+$ qmake6
+$ make
+# make install
+$ cd ../repoeditor
+$ qmake6
+$ make
+# make install
+$ cd ..
+$ qmake6
+$ make
+# make install
 ```
 
-You can also use the available PKGBUILD script that helps you build Octopi with all its tools:
+You can also use the available PKGBUILD script that helps you build latest Octopi development version with all its tools(*):
 
 ```
-$ cd OCTOPI_PATH
+$ cd OCTOPI_PATH (where you git cloned the source code)
 $ makepkg -f
 ```
 
-### How to enable the "alien" icon at toolbar
+(*) It may contain bugs. You have been warned.
 
-To enable AUR support, you'll need to install "yaourt" or "pacaur" in your system.  
-In Chakra, "ccr" will be supported out of the box.  
-In KaOS, "kcp" will be supported out of the box.
+### Steps to build Octopi source code (CMake)
+
+As an alternative to qmake, Octopi can also be built with CMake. Make sure that at least CMake 3.5 is installed.
+
+First, build and install alpm_octopi_utils:
+
+```
+$ git clone https://github.com/aarnt/alpm_octopi_utils
+$ cd alpm_octopi_utils
+$ mkdir build_dir && cd build_dir
+$ cmake -G "Unix Makefiles" .. -DCMAKE_BUILD_TYPE=Release -DCMAKE_INSTALL_PREFIX=/usr
+$ make
+$ sudo make install
+```
+
+Next, build and install Octopi:
+
+```
+$ git clone https://github.com/aarnt/octopi
+$ cd octopi
+$ mkdir build_dir && cd build_dir
+$ cmake -G "Unix Makefiles" .. -DCMAKE_BUILD_TYPE=Release -DCMAKE_INSTALL_PREFIX=/usr
+$ make
+$ sudo make install
+```
+
+### To run Octopi
+
+```
+$ /usr/bin/octopi
+```
+
+### To run Octopi Notifier
+
+```
+$ /usr/bin/octopi-notifier
+```
+
+### To enable AUR support (that "green alien" icon on toolbar)
+
+You'll need to install [pacaur](https://github.com/rmarquis/pacaur), [paru](https://github.com/morganamilo/paru),
+[pikaur](https://github.com/actionless/pikaur), [trizen](https://github.com/trizen/trizen) or
+[yay](https://github.com/Jguer/yay) in your system.
+If neither of the previous tools are found Octopi will download latest "yay-bin" github binary.
+In KaOS, [kcp](https://codeberg.org/bvaudour/kcp) will be supported out of the box.
 
 ### Ways to help/support Octopi
 
- * You can "Star" it at the Github page - https://github.com/aarnt/octopi
- * You can vote in the AUR package available at https://aur.archlinux.org/packages/octopi/
- * You can translate it to your mother language at https://www.transifex.com/projects/p/octopi/
- * You can follow author's twitter account at https://twitter.com/aaarnt
- * You can buy author's technical book (currently in portuguese) about Octopi and Qt5 at 
+ * You can "Star" it on the Github page - https://github.com/aarnt/octopi/
+ * You can vote in the AUR package available on https://aur.archlinux.org/packages/octopi/
+ * You can translate it to your mother language on https://explore.transifex.com/arnt/octopi/
+ * You can follow author's twitter account on https://twitter.com/aaarnt
+ * You can buy author's technical book (currently in portuguese) about Octopi and Qt5 on
 http://www.amazon.com.br/Aprendendo-Qt-com-projeto-Octopi-ebook/dp/B015ICHKV6
+ * You can buy author's poem book (currently in portuguese) on meditation, Buddhism, cosmology and other subjects on
+https://www.amazon.com.br/Avidya-Alexandre-Arnt-ebook/dp/B0965LVWR3
  * You can write a review about it (text / video)
- * You can donate money to the project Paypal - http://sourceforge.net/donate/index.php?group_id=186459
+ * You can donate money to the author's Paypal - http://sourceforge.net/donate/index.php?group_id=186459
  * You can join the project ;-)
 
 

cachecleaner/.tx/config

@@ -1,8 +1,11 @@
 [main]
 host = https://www.transifex.com
 
-[octopi.cachecleaner]
-file_filter = resources/translations/octopi_cachecleaner_<lang>.ts
-source_file = resources/translations/octopi_cachecleaner_en.ts
-source_lang = en
-type = QT
+[o:arnt:p:octopi:r:cachecleaner]
+file_filter            = resources/translations/octopi_cachecleaner_<lang>.ts
+source_file            = resources/translations/octopi_cachecleaner_en.ts
+source_lang            = en
+type                   = QT
+replace_edited_strings = false
+keep_translations      = false
+

cachecleaner/CMakeLists.txt

@@ -0,0 +1,66 @@
+if (USE_QTERMWIDGET6)
+  find_package(Qt6 REQUIRED COMPONENTS Core Network Xml Widgets LinguistTools)
+else()
+  find_package(Qt5 REQUIRED COMPONENTS Core Network Xml Widgets LinguistTools)
+endif()
+
+set(CMAKE_AUTOMOC ON)
+
+file(GLOB TS_FILES LIST_DIRECTORIES false "${CMAKE_CURRENT_LIST_DIR}/resources/translations/*.ts")
+qt_add_translation(qmFiles ${TS_FILES})
+
+set(src 
+    main.cpp
+    cachecleaner.cpp
+    packagegroupmodel.cpp
+    ../src/strconstants.cpp
+    ../src/qaesencryption.cpp
+    ../src/unixcommand.cpp
+    ../src/wmhelper.cpp
+    ../src/terminal.cpp
+    ../src/settingsmanager.cpp
+    ../src/searchlineedit.cpp
+    ../src/utils.cpp
+    ../src/package.cpp
+    ../src/QtSolutions/qtsingleapplication.cpp
+    ../src/QtSolutions/qtlocalpeer.cpp
+    #../src/QtSolutions/qtlockedfile.cpp
+    ../src/QtSolutions/qtsinglecoreapplication.cpp)
+
+set(header 
+    cachecleaner.h
+    packagegroupmodel.h
+    ../src/strconstants.h
+    ../src/qaesencryption.h
+    ../src/unixcommand.h
+    ../src/wmhelper.h
+    ../src/terminal.h
+    ../src/settingsmanager.h
+    ../src/searchlineedit.h
+    ../src/utils.h
+    ../src/package.h
+    ../src/QtSolutions/qtsingleapplication.h
+    ../src/QtSolutions/qtlocalpeer.h
+    #../src/QtSolutions/qtlockedfile.h
+    ../src/QtSolutions/qtsinglecoreapplication.h)
+
+set(ui ui/cachecleaner.ui)
+
+set(qrc resources.qrc)
+
+qt_wrap_ui(src ${ui})
+qt_add_resources(src ${qrc})
+    
+add_executable(octopi-cachecleaner ${src} ${header} ${qmFiles})
+target_compile_definitions(octopi-cachecleaner PRIVATE QT_USE_QSTRINGBUILDER QT_NO_CAST_FROM_ASCII QT_NO_CAST_TO_ASCII QT_NO_URL_CAST_FROM_STRING QT_NO_CAST_FROM_BYTEARRAY)
+
+if (USE_QTERMWIDGET6)
+  target_include_directories(octopi-cachecleaner PRIVATE ${CMAKE_CURRENT_BINARY_DIR} "${CMAKE_CURRENT_SOURCE_DIR}/src/QtSolutions" ${Qt6Core_INCLUDE_DIRS} ${Qt6Network_INCLUDE_DIRS} ${Qt6Xml_INCLUDE_DIRS} ${Qt6Widgets_INCLUDE_DIRS})
+  target_link_libraries(octopi-cachecleaner PRIVATE Qt6::Core Qt6::Network Qt6::Xml Qt6::Widgets)
+else()
+  target_include_directories(octopi-cachecleaner PRIVATE ${CMAKE_CURRENT_BINARY_DIR} "${CMAKE_CURRENT_SOURCE_DIR}/src/QtSolutions" ${Qt5Core_INCLUDE_DIRS} ${Qt5Network_INCLUDE_DIRS} ${Qt5Xml_INCLUDE_DIRS} ${Qt5Widgets_INCLUDE_DIRS})
+  target_link_libraries(octopi-cachecleaner PRIVATE Qt5::Core Qt5::Network Qt5::Xml Qt5::Widgets)
+endif()
+
+install(TARGETS octopi-cachecleaner RUNTIME DESTINATION bin LIBRARY DESTINATION lib PUBLIC_HEADER DESTINATION include)
+install(FILES "${CMAKE_CURRENT_SOURCE_DIR}/octopi-cachecleaner.desktop" DESTINATION share/applications)

cachecleaner/cachecleaner.cpp

@@ -20,9 +20,13 @@ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA
 
 #include "cachecleaner.h"
 #include "ui_cachecleaner.h"
-
 #include "../src/strconstants.h"
 
+#include <QKeyEvent>
+#include <QTcpServer>
+#include <QTcpSocket>
+#include <QMessageBox>
+
 /*
  * CacheCleaner window constructor
  */
@@ -30,7 +34,6 @@ CacheCleaner::CacheCleaner(QWidget *parent) :
   QMainWindow(parent),
   ui(new Ui::CacheCleaner)
 {
-
   //UI initialization
   ui->setupUi(this);
 
@@ -40,19 +43,23 @@ CacheCleaner::CacheCleaner(QWidget *parent) :
   int keepUninstalled = SettingsManager::getKeepNumUninstalledPackages();
   ui->keepUninstalledPackagesSpinner->setValue(keepUninstalled);
 
-
   //create package group wrappers
-  m_installed = new PackageGroupModel("",
+  m_installed = new PackageGroupModel(QLatin1String(""),
                                       ui->installedPackagesList,
                                       ui->keepInstalledPackagesSpinner,
                                       ui->refreshInstalledButton,
                                       ui->cleanInstalledButton);
 
-  m_uninstalled = new PackageGroupModel("-u",
+  m_uninstalled = new PackageGroupModel(QStringLiteral("-u"),
                                         ui->uninstalledPackagesList,
                                         ui->keepUninstalledPackagesSpinner,
-                                        ui->refreshUninstalledButton,
+                                        ui->refreshUninstalledButton,                                                                                
                                         ui->cleanUninstalledButton);
+
+  m_tcpServer = new QTcpServer(this);
+  connect(m_tcpServer, &QTcpServer::newConnection, this, &CacheCleaner::onSendInfoToOctopiHelper);
+
+  restoreGeometry(SettingsManager::getCacheCleanerWindowSize());
 }
 
 /*
@@ -65,11 +72,88 @@ CacheCleaner::~CacheCleaner()
   delete ui;
 }
 
+/*
+ * Start listening for helper connections
+ */
+bool CacheCleaner::startServer()
+{
+  bool res=true;
+
+  if (!m_tcpServer->listen(QHostAddress::LocalHost, 12703))
+  {
+    QMessageBox::critical(this, StrConstants::getApplicationName(),
+                          QStringLiteral("Unable to start the server: %1.")
+                          .arg(m_tcpServer->errorString()));
+    res=false;
+  }
+
+  return res;
+}
+
+/*
+ * Answers Helper if CacheCleaner is executing actions
+ */
+void CacheCleaner::onSendInfoToOctopiHelper()
+{
+  QString msg;
+  QByteArray block;
+  QDataStream out(&block, QIODevice::WriteOnly);
+  out.setVersion(QDataStream::Qt_5_15);
+
+  //Is octopi-helper running?
+  bool isHelperExecuting=UnixCommand::isOctopiHelperRunning();
+
+  bool commandExecuting = (m_installed->isExecutingCommand || m_uninstalled->isExecutingCommand);
+
+  if (isHelperExecuting && commandExecuting)
+  {
+    msg=QLatin1String("Octopi est occupatus");
+    out << msg;
+  }
+  else if (isHelperExecuting && !commandExecuting)
+  {
+    msg=QLatin1String("Octopi serenum est");
+    out << msg;
+  }
+  else
+  {
+    msg=QLatin1String("Atramento nigro");
+    out << msg;
+  }
+
+  QTcpSocket *clientConnection = m_tcpServer->nextPendingConnection();
+  if (clientConnection->isOpen())
+  {
+    connect(clientConnection, &QAbstractSocket::disconnected,
+          clientConnection, &QObject::deleteLater);
+
+    clientConnection->write(block);
+    clientConnection->disconnectFromHost();
+  }
+
+  //m_installed->isExecutingCommand=false;
+  //m_uninstalled->isExecutingCommand=false;
+}
+
 /*
  * Save settings when closing window
  */
 void CacheCleaner::closeEvent(QCloseEvent *)
 {
+  QByteArray windowSize=saveGeometry();
+
+  SettingsManager::setCacheCleanerWindowSize(windowSize);
   SettingsManager::setKeepNumInstalledPackages(ui->keepInstalledPackagesSpinner->value());
   SettingsManager::setKeepNumUninstalledPackages(ui->keepUninstalledPackagesSpinner->value());
 }
+
+/*
+ * Whenever user presses ESC, we quit the program
+ */
+void CacheCleaner::keyPressEvent(QKeyEvent *ke)
+{
+  if (ke->key() == Qt::Key_Escape)
+  {
+    close();
+  }
+}

cachecleaner/cachecleaner.h

@@ -25,6 +25,8 @@ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA
 
 #include "packagegroupmodel.h"
 
+class QTcpServer;
+
 namespace Ui {
 class CacheCleaner;
 }
@@ -38,16 +40,21 @@ class CacheCleaner : public QMainWindow
 
 private:
     Ui::CacheCleaner *ui;
-
     PackageGroupModel *m_installed;
     PackageGroupModel *m_uninstalled;
+    QTcpServer *m_tcpServer;
+
+private slots:
+  void onSendInfoToOctopiHelper();
 
 public:
     explicit CacheCleaner(QWidget *parent = 0);
     ~CacheCleaner();
+    bool startServer();
 
 protected:
     void closeEvent(QCloseEvent *);
+    void keyPressEvent(QKeyEvent *);
 };
 
 #endif // CACHECLEANER_H

cachecleaner/main.cpp

@@ -19,10 +19,11 @@ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA
 */
 
 #include "cachecleaner.h"
-
+#include "../src/strconstants.h"
 #include "../src/QtSolutions/qtsingleapplication.h"
 
 #include <QApplication>
+#include <QMessageBox>
 #include <QTranslator>
 #include <QLocale>
 #include <QLibraryInfo>
@@ -30,27 +31,64 @@ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA
 
 int main( int argc, char *argv[] )
 {
-  QtSingleApplication app( "Cache Cleaner - Octopi", argc, argv );
+  unsetenv("TMPDIR");
+  QtSingleApplication app( QStringLiteral("Cache Cleaner - Octopi"), argc, argv );
 
   //If there is already an instance running...
   if (app.isRunning())
   {
-    app.sendMessage("RAISE");
+    app.sendMessage(QStringLiteral("RAISE"));
     return 0;
   }
 
-  app.sendMessage("RAISE");
+  app.sendMessage(QStringLiteral("RAISE"));
 
   QTranslator appTranslator;
-  appTranslator.load(":/resources/translations/octopi_cachecleaner_" +
-                     QLocale::system().name());
+  bool success = appTranslator.load(QLatin1String(":/resources/translations/octopi_cachecleaner_") +
+                     QLocale::system().name()); 
+  if (!success)
+  {
+    success = appTranslator.load(QStringLiteral(":/resources/translations/octopi_cachecleaner_en.qm"));
+  }
+
   app.installTranslator(&appTranslator);
 
+  if (UnixCommand::isRootRunning()){
+    QMessageBox::critical( nullptr, StrConstants::getApplicationName(), StrConstants::getErrorRunningWithRoot());
+    return (-2);
+  }
+
+  if (!UnixCommand::hasTheExecutable(QStringLiteral("paccache")))
+  {
+    QMessageBox::critical( nullptr, StrConstants::getApplicationName(), StrConstants::getExecutableCouldNotBeFound().arg(QStringLiteral("\"paccache\"")));
+    return (-3);
+  }
+
+  if (!QFile::exists(ctn_OCTOPI_HELPER_PATH))
+  {
+    qDebug() << "Aborting cache-cleaner as 'octphelper' binary could not be found! [" << ctn_OCTOPI_HELPER_PATH << "]";
+    return (-4);
+  }
+
+  if (!QFile::exists(ctn_OCTOPISUDO))
+  {
+    qDebug() << "Aborting cache-cleaner as 'octopi-sudo' binary could not be found! [" << ctn_OCTOPISUDO << "]";
+    return (-5);
+  }
+
+  if (!UnixCommand::isOctoToolRunning(QStringLiteral("octopi-cachecleaner")))
+  {
+    QMessageBox::critical(nullptr, StrConstants::getApplicationName(), StrConstants::getErrorRunOctopiCacheCleanerAsUsrBin());
+    return (-6);
+  }
+
   CacheCleaner w;
-  app.setActivationWindow(&w);
-  w.show();
+  if (w.startServer())
+  {
+    app.setActivationWindow(&w);
+    w.show();
+    QResource::registerResource(QStringLiteral("./resources.qrc"));
 
-  QResource::registerResource("./resources.qrc");
-
-  return app.exec();
+    return app.exec();
+  }
 }

cachecleaner/octopi-cachecleaner.desktop

@@ -1,9 +1,11 @@
 [Desktop Entry]
 Name=Octopi CacheCleaner
 Icon=octopi
-Exec=octopi-cachecleaner
+Exec=/usr/bin/octopi-cachecleaner
 Terminal=false
 Type=Application
 Categories=GNOME;GTK;System;
 #NotShowIn=GNOME;XFCE;LXDE;KDE;
 StartupNotify=true
+Version=1.5
+SingleMainWindow=true

cachecleaner/octopi-cachecleaner.pro

@@ -7,6 +7,14 @@
 QT += core gui network xml widgets
 
 CONFIG += qt console warn_on debug
+
+# Disable automatic string conversions
+DEFINES += QT_USE_QSTRINGBUILDER \
+           QT_NO_CAST_FROM_ASCII \
+           QT_NO_CAST_TO_ASCII \
+           QT_NO_URL_CAST_FROM_STRING \
+           QT_NO_CAST_FROM_BYTEARRAY
+
 TEMPLATE = app
 DESTDIR += bin
 OBJECTS_DIR += build
@@ -16,10 +24,12 @@ UI_DIR += build
 HEADERS +=  cachecleaner.h \
             packagegroupmodel.h \
             ../src/strconstants.h \
+            ../src/qaesencryption.h \
             ../src/unixcommand.h \
             ../src/wmhelper.h \
             ../src/terminal.h \
             ../src/settingsmanager.h \
+            ../src/searchlineedit.h \
             ../src/utils.h \
             ../src/package.h \
             ../src/QtSolutions/qtsingleapplication.h \
@@ -31,10 +41,13 @@ HEADERS +=  cachecleaner.h \
 SOURCES +=  main.cpp \
             cachecleaner.cpp \
             packagegroupmodel.cpp \
+            ../src/strconstants.cpp \
+            ../src/qaesencryption.cpp \
             ../src/unixcommand.cpp \
             ../src/wmhelper.cpp \
             ../src/terminal.cpp \
             ../src/settingsmanager.cpp \
+            ../src/searchlineedit.cpp \
             ../src/utils.cpp \
             ../src/package.cpp \
             ../src/QtSolutions/qtsingleapplication.cpp \
@@ -48,6 +61,7 @@ RESOURCES += resources.qrc
     
 TRANSLATIONS += resources/translations/octopi_cachecleaner_pt_BR.ts \
     resources/translations/octopi_cachecleaner_fr_FR.ts \
+    resources/translations/octopi_cachecleaner_fr.ts \
     resources/translations/octopi_cachecleaner_es_ES.ts \
     resources/translations/octopi_cachecleaner_es_419.ts \
     resources/translations/octopi_cachecleaner_es_AR.ts \
@@ -64,6 +78,8 @@ TRANSLATIONS += resources/translations/octopi_cachecleaner_pt_BR.ts \
     resources/translations/octopi_cachecleaner_da.ts \
     resources/translations/octopi_cachecleaner_cs.ts \
     resources/translations/octopi_cachecleaner_he.ts \
+    resources/translations/octopi_cachecleaner_hi.ts \
+    resources/translations/octopi_cachecleaner_hi_IN.ts \
     resources/translations/octopi_cachecleaner_lt.ts \
     resources/translations/octopi_cachecleaner_nb.ts \
     resources/translations/octopi_cachecleaner_sr@latin.ts \
@@ -77,6 +93,7 @@ TRANSLATIONS += resources/translations/octopi_cachecleaner_pt_BR.ts \
     resources/translations/octopi_cachecleaner_en_GB.ts \
     resources/translations/octopi_cachecleaner_pt_PT.ts \
     resources/translations/octopi_cachecleaner_sv.ts \
+    resources/translations/octopi_cachecleaner_sl.ts \
     resources/translations/octopi_cachecleaner_hu.ts \
     resources/translations/octopi_cachecleaner_zh_TW.ts \
     resources/translations/octopi_cachecleaner_ms_MY.ts \
@@ -87,4 +104,29 @@ TRANSLATIONS += resources/translations/octopi_cachecleaner_pt_BR.ts \
     resources/translations/octopi_cachecleaner_gl_ES.ts \
     resources/translations/octopi_cachecleaner_ast.ts \
     resources/translations/octopi_cachecleaner_hr.ts \
-    resources/translations/octopi_cachecleaner_zh-Hans.ts
+    resources/translations/octopi_cachecleaner_zh-Hans.ts \
+    resources/translations/octopi_cachecleaner_zh_CN.ts \
+    resources/translations/octopi_cachecleaner_ko.ts \
+    resources/translations/octopi_cachecleaner_ko_KR.ts \
+    
+# install
+isEmpty(PREFIX) {
+    PREFIX = /usr
+}
+ 
+isEmpty(BINDIR) {
+    BINDIR = $$PREFIX/bin
+}
+
+isEmpty(DATADIR) {
+    DATADIR = $$PREFIX/share
+}
+    
+target.path = $$BINDIR
+sources.files = $$SOURCES $$HEADERS $$RESOURCES $$FORMS *.pro 
+sources.path = .
+
+desktop.path = $$DATADIR/applications
+desktop.files += cachecleaner/octopi-cachecleaner.desktop
+
+INSTALLS += target desktop

cachecleaner/packagegroupmodel.cpp

@@ -21,6 +21,7 @@ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA
 #include "packagegroupmodel.h"
 #include "../src/strconstants.h"
 
+#include <QSharedMemory>
 #include <QApplication>
 #include <QMessageBox>
 
@@ -37,7 +38,7 @@ PackageGroupModel::PackageGroupModel(QString optionsString,
                                      QSpinBox *spinner,
                                      QPushButton *refreshBtn,
                                      QPushButton *cleanBtn)
-                                        : QObject(NULL),
+                                        : QObject(nullptr),
                                         m_optionsString(optionsString), 
                                         m_listView(listView), 
                                         m_spinner(spinner), 
@@ -49,6 +50,8 @@ PackageGroupModel::PackageGroupModel(QString optionsString,
 {
   m_cleanButton->setText(tr("Clean"));
 
+  m_sharedMemory=new QSharedMemory(QStringLiteral("org.arnt.octopi"), this);
+
   //setup UI slots
   connect( m_spinner, SIGNAL( valueChanged(int) ), SLOT( updateKeepArchives() ) );
   connect( m_spinner, SIGNAL( valueChanged(int) ), SLOT( refreshCacheView() ) );
@@ -56,6 +59,8 @@ PackageGroupModel::PackageGroupModel(QString optionsString,
   connect( m_refreshButton, SIGNAL( clicked() ), SLOT( refreshCacheView() ) );
   connect( m_cleanButton, SIGNAL( clicked() ), SLOT( cleanCache() ) );
 
+  isExecutingCommand = false;
+
   //refresh cache informations at startup
   refreshCacheView();
 }
@@ -65,6 +70,7 @@ PackageGroupModel::PackageGroupModel(QString optionsString,
  */
 PackageGroupModel::~PackageGroupModel()
 {
+  //UnixCommand::removeSharedMemFiles();
   delete m_acc;
   delete m_cmd;
 }
@@ -94,7 +100,7 @@ void PackageGroupModel::keepArchivesChanged()
  */
 QString PackageGroupModel::getOptions()
 {
-  return m_optionsString + " -k " + QString::number(m_spinner->value());
+  return QStringLiteral("%1-k %2").arg(m_optionsString).arg(m_spinner->value());
 }
 
 /*
@@ -102,6 +108,8 @@ QString PackageGroupModel::getOptions()
  */
 void PackageGroupModel::refreshCacheView()
 {
+  if (isExecutingCommand) return;
+
   //update UI for background refresh
   QApplication::setOverrideCursor(Qt::WaitCursor);
   m_acc->reset();
@@ -115,7 +123,13 @@ void PackageGroupModel::refreshCacheView()
   QObject::connect(m_cmd, SIGNAL( finished ( int, QProcess::ExitStatus )),
                    this, SLOT( finishedDryrun ( int, QProcess::ExitStatus )) );
 
-  m_cmd->executeCommandAsNormalUser("paccache -v -d " + getOptions());
+  QStringList sl;
+  sl << QStringLiteral("-v");
+  sl << QStringLiteral("-d");
+  QStringList opt = getOptions().split(QStringLiteral(" "), Qt::SkipEmptyParts);
+  sl << opt;
+  m_cmd->executeCommandAsNormalUser(QStringLiteral("/usr/bin/paccache"), sl);
+  isExecutingCommand = true;
 }
 
 /*
@@ -130,9 +144,9 @@ bool PackageGroupModel::isSUAvailable()
     return true;
   }
   else if (WMHelper::getSUCommand() == ctn_NO_SU_COMMAND){
-    QMessageBox::critical( 0, StrConstants::getApplicationName(),
+    QMessageBox::critical( nullptr, StrConstants::getApplicationName(),
                            StrConstants::getErrorNoSuCommand() +
-                           "\n" + StrConstants::getYoullNeedSuFrontend());
+                           QLatin1String("\n") + StrConstants::getYoullNeedSuFrontend());
     return false;
   }
   else
@@ -144,6 +158,12 @@ bool PackageGroupModel::isSUAvailable()
  */
 void PackageGroupModel::cleanCache()
 {
+  if (isExecutingCommand || UnixCommand::isPacmanDbLocked()){
+    QMessageBox::critical( nullptr, StrConstants::getApplicationName(),
+                           StrConstants::getErrorDbLock());
+    return;
+  }
+
   if (!isSUAvailable())
     return;
 
@@ -157,8 +177,10 @@ void PackageGroupModel::cleanCache()
   QObject::connect(m_cmd, SIGNAL( finished ( int, QProcess::ExitStatus )),
                    this, SLOT( finishedClean( int, QProcess::ExitStatus )) );
 
-  QByteArray tmp = "paccache -r " + getOptions().toLatin1();
-  m_cmd->executeCommand(QLatin1String(tmp), ectn_LANG_USER_DEFINED);
+  isExecutingCommand = true;
+  const QString tmp = QLatin1String("paccache -r ") + getOptions();
+  //UnixCommand::removeTemporaryFiles();
+  m_cmd->executeCommandWithSharedMemHelper(tmp, m_sharedMemory);
 }
 
 /*
@@ -172,10 +194,12 @@ void PackageGroupModel::finishedDryrun(int exitCode, QProcess::ExitStatus)
 
   QApplication::restoreOverrideCursor();
 
+  isExecutingCommand = false;
+
   if(exitCode > 1)
   {
     //process failed, provide info on errors
-    QMessageBox::critical(m_listView, "Error whith the underlying process", m_acc->getErrors());
+    QMessageBox::critical(m_listView, QStringLiteral("Error with the underlying process"), m_acc->getErrors());
   }
   else if (exitCode == 0)
   {
@@ -198,10 +222,11 @@ void PackageGroupModel::finishedClean(int exitCode, QProcess::ExitStatus)
 
   QApplication::restoreOverrideCursor();
 
+  isExecutingCommand = false;
+
   if(exitCode != 0)
   {
-    //process failed, provide info on errors
-    QMessageBox::critical(m_listView, "Error whith the underlying process",m_acc->getErrors());
+    //process failed, return to main window
     m_refreshButton->setEnabled(true);
     m_cleanButton->setEnabled(true);
   }
@@ -218,9 +243,9 @@ void PackageGroupModel::finishedClean(int exitCode, QProcess::ExitStatus)
  * @param output The output of the dryrun process
  */
 void PackageGroupModel::processDryrunResult(QString output) {
-  QStringList lines = output.split(QRegExp("\\n"), QString::SkipEmptyParts);
+  QStringList lines = output.split(QRegularExpression(QStringLiteral("\\n")), Qt::SkipEmptyParts);
 
-  if(lines.length() == 1 || output.contains("*.pkg.tar?(.+([^.]))"))
+  if(lines.length() == 1 || output.contains(QLatin1String("*.pkg.tar?(.+([^.]))")))
   {
     //"==> no candidate packages found for pruning"
     m_cleanButton->setText(tr("Clean"));
@@ -230,7 +255,7 @@ void PackageGroupModel::processDryrunResult(QString output) {
     //process package list
     for(int i = 0; i < lines.length(); i++)
     {
-      QString line = lines.at(i);
+      const QString& line = lines.at(i);
 
       if(i == 0)
         //skip the first line ("==> Candidate packages:")
@@ -239,14 +264,14 @@ void PackageGroupModel::processDryrunResult(QString output) {
       else if(i == lines.length() - 1)
       {
         //extract size from "==> finished dry run: 8 candidates (disk space saved: 19.11 MiB)")
-        QStringList components = line.split(" ");
+        QStringList components = line.split(QStringLiteral(" "));
 
         QString unit = components.takeLast();
         unit.remove(unit.length() - 1, 1);
 
         QString size = components.takeLast();
 
-        m_cleanButton->setText(tr("Clean %1").arg(" " + size + " " + unit));
+        m_cleanButton->setText(tr("Clean %1").arg(QLatin1Char(' ') + size + QLatin1Char(' ') + unit));
       }
       else
         m_listView->addItem(line);

cachecleaner/packagegroupmodel.h

@@ -82,10 +82,12 @@ class PackageGroupModel : public QObject
 
 private:
   bool isSUAvailable();
+  QSharedMemory *m_sharedMemory;
 
 public:
     PackageGroupModel(QString, QListWidget *, QSpinBox *, QPushButton *, QPushButton *);
     ~PackageGroupModel();
+    bool isExecutingCommand;
 
 protected:
     QString m_optionsString;

cachecleaner/release-languages.sh

@@ -1,9 +0,0 @@
-#/bin/sh
-# Helper for Qt5 libs to generate all Octopi translations
-
-TRANSLATIONS=./resources/translations/*
-
-for f in $TRANSLATIONS
-do
-  lrelease-qt5 $f
-done

cachecleaner/resources.qrc

@@ -18,7 +18,10 @@
         <file>resources/translations/octopi_cachecleaner_fi.qm</file>
         <file>resources/translations/octopi_cachecleaner_fi_FI.qm</file>
         <file>resources/translations/octopi_cachecleaner_fr_FR.qm</file>
+        <file>resources/translations/octopi_cachecleaner_fr.qm</file>
         <file>resources/translations/octopi_cachecleaner_he.qm</file>
+        <file>resources/translations/octopi_cachecleaner_hi.qm</file>
+        <file>resources/translations/octopi_cachecleaner_hi_IN.qm</file>
         <file>resources/translations/octopi_cachecleaner_hu.qm</file>
         <file>resources/translations/octopi_cachecleaner_id.qm</file>
         <file>resources/translations/octopi_cachecleaner_it.qm</file>
@@ -36,12 +39,16 @@
         <file>resources/translations/octopi_cachecleaner_sr@latin.qm</file>
         <file>resources/translations/octopi_cachecleaner_sr_RS.qm</file>
         <file>resources/translations/octopi_cachecleaner_sv.qm</file>
+        <file>resources/translations/octopi_cachecleaner_sl.qm</file>
         <file>resources/translations/octopi_cachecleaner_tr_TR.qm</file>
+        <file>resources/translations/octopi_cachecleaner_tr.qm</file>
         <file>resources/translations/octopi_cachecleaner_uk.qm</file>
         <file>resources/translations/octopi_cachecleaner_uz.qm</file>
         <file>resources/translations/octopi_cachecleaner_vi.qm</file>
         <file>resources/translations/octopi_cachecleaner_zh_TW.qm</file>
-        <file>resources/translations/octopi_cachecleaner_zh-Hans.ts</file>
+        <file>resources/translations/octopi_cachecleaner_zh-Hans.qm</file>
+        <file>resources/translations/octopi_cachecleaner_zh_CN.qm</file>
         <file>resources/translations/octopi_cachecleaner_hr.qm</file>
+        <file>resources/translations/octopi_cachecleaner_ko.qm</file>
     </qresource>
 </RCC>

cachecleaner/resources/translations/octopi_cachecleaner_af.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="af" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_af_ZA.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="af_ZA" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_ast.ts

@@ -4,7 +4,7 @@
     <message>
         <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
         <source>Cache Cleaner - Octopi</source>
-        <translation>Llimpiador de caché - Octopi</translation>
+        <translation>Llimpiador de la caché - Octopi</translation>
     </message>
     <message>
         <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
@@ -21,7 +21,7 @@
         <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
         <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
         <source>Number of old versions to keep</source>
-        <translation>Númberu de versiones vieyes pa caltener</translation>
+        <translation>Númberu de versiones vieyes a caltener</translation>
     </message>
     <message>
         <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>

cachecleaner/resources/translations/octopi_cachecleaner_be.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="be" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_be_BY.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="be_BY" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_bg.ts

@@ -4,12 +4,12 @@
     <message>
         <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
         <source>Cache Cleaner - Octopi</source>
-        <translation>Чистач на кеш памет - Octopi</translation>
+        <translation>Почистване на кеша - „Octopi“</translation>
     </message>
     <message>
         <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
         <source>Uninstalled packages</source>
-        <translation>Деинсталирани пакети</translation>
+        <translation>Премахнати пакети</translation>
     </message>
     <message>
         <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>

cachecleaner/resources/translations/octopi_cachecleaner_bs.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="bs" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_bs_BA.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="bs_BA" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation>Keš čistač - Octopi</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation>Deinstalirani paketi</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation>Zadrži</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation>Zadržati broj starih verzija</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation>Osvježi</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation>Instalirani paketi</translation>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation>Očisti</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation>Očisti %1</translation>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_ca.ts

@@ -4,7 +4,7 @@
     <message>
         <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
         <source>Cache Cleaner - Octopi</source>
-        <translation>Netejador de la Cau/Cache - Octopi</translation>
+        <translation>Netejador de la cau - Octopi</translation>
     </message>
     <message>
         <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
@@ -15,7 +15,7 @@
         <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
         <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
         <source>Keep :</source>
-        <translation>Mantenir :</translation>
+        <translation>Mantén:</translation>
     </message>
     <message>
         <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>

cachecleaner/resources/translations/octopi_cachecleaner_cmn.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="cmn" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_cs_CZ.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="cs_CZ" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_da.ts

@@ -4,7 +4,7 @@
     <message>
         <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
         <source>Cache Cleaner - Octopi</source>
-        <translation>Cache Renser - Octopi</translation>
+        <translation>Cache-renser - Octopi</translation>
     </message>
     <message>
         <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>

cachecleaner/resources/translations/octopi_cachecleaner_de.ts

@@ -4,7 +4,7 @@
     <message>
         <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
         <source>Cache Cleaner - Octopi</source>
-        <translation>Cache säubern - Octopi</translation>
+        <translation>Zwischenspeicher säubern - Octopi</translation>
     </message>
     <message>
         <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>

cachecleaner/resources/translations/octopi_cachecleaner_de_AT.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="de_AT" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_de_DE.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="de_DE" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_en_CZ.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="en_CZ" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_en_IN.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="en_IN" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_en_PL.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="en_PL" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_en_SE.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="en_SE" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_eo.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="eo" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation>Malinstalitaj Pakaĵoj</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation>Konservi :</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation>Refreŝigi</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation>Instalitaj Pakaĵoj</translation>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation>Purigi</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation>Purigi %1</translation>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_es.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="es" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation>Limpiador de caché</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation>Paquetes desinstalados</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation>Mantener:</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation>Número de versiones antiguas a mantener</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation>Refrescar</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation>Paquetes instalados</translation>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation>Limpiar</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation>Limpiar %1</translation>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_es_CL.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="es_CL" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation>Limpiador Cache-Octopi</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation>Paquetes desinstalados</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation>Mantener :</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation>Número de versiones anteriores a mantener</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation>Refrescar</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation>Paquetes instalados</translation>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation>Limpiar</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation>Limpiar %1</translation>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_es_CR.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="es_CR" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_es_MX.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="es_MX" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation>Limpiador de Caché - Octopi</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation>Paquetes desinstalados</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation>Conservar:</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation>Número de versión anterior a conservar</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation>Actualizar</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation>Paquetes instalados</translation>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation>Limpiar</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation>Limpiar %1</translation>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_es_NI.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="es_NI" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_es_PE.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="es_PE" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation>Borrar Cache - Octopi</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation>Refrescar</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation>Borrar</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_fa_IR.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="fa_IR" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation>Cache Cleaner - Octopi</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation>بسته های حذف شده</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation>نگه‌داری</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation>تعداد ورژن‌هایی که باقی می‌مانند</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation>تازه سازی</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation>بسته های نصب شده</translation>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation>تمیز کردن</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation>پاک کردن 1%</translation>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_fi.ts

@@ -15,7 +15,7 @@
         <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
         <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
         <source>Keep :</source>
-        <translation>Säilytä</translation>
+        <translation>Säilytä:</translation>
     </message>
     <message>
         <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>

cachecleaner/resources/translations/octopi_cachecleaner_fi_FI.ts

@@ -40,12 +40,12 @@
     <message>
         <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
         <source>Clean</source>
-        <translation>Putsaa</translation>
+        <translation>Tyhjennä</translation>
     </message>
     <message>
         <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
         <source>Clean %1</source>
-        <translation>Putsattu 1%</translation>
+        <translation>Tyhjennä %1</translation>
     </message>
 </context>
 </TS>

cachecleaner/resources/translations/octopi_cachecleaner_fr.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="fr" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation>Nettoyeur de cache - Octopi</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation>Paquets non installés</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation>Conserver :</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation>Nombre d&apos;anciennes versions à conserver</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation>Actualiser</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation>Paquets installés</translation>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation>Nettoyer</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation>Nettoyer %1</translation>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_fr_CA.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="fr_CA" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation type="unfinished"/>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation type="unfinished"/>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_fr_CH.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="fr_CH" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation>Nettoyeur de cache - Octopi</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation>Paquets non-installés</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation>Conserver :</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation>Nombre d&apos;anciennes versions à conserver</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation>Actualiser</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation>Paquets installés</translation>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation>Nettoyer</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation>Nettoyer %1</translation>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_hi.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="hi" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation>कैश हटाने हेतु साधन - ऑक्टोपी</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation>हटाए गए पैकेज</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation>रखें :</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation>रखने हेतु पुराने पैकेज की संस्करण संख्या</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation> रिफ्रेश करें</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation>इंस्टॉल हो रखें पैकेज</translation>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation>हटाएँ</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation>%1 हटाएँ</translation>
+    </message>
+</context>
+</TS>

cachecleaner/resources/translations/octopi_cachecleaner_hi_IN.ts

@@ -0,0 +1,51 @@
+<?xml version="1.0" ?><!DOCTYPE TS><TS language="hi_IN" version="2.0">
+<context>
+    <name>CacheCleaner</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="14"/>
+        <source>Cache Cleaner - Octopi</source>
+        <translation>कैश हटाने हेतु साधन - ऑक्टोपी</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="49"/>
+        <source>Uninstalled packages</source>
+        <translation>हटाए गए पैकेज</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="75"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="150"/>
+        <source>Keep :</source>
+        <translation>रखें :</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="82"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="157"/>
+        <source>Number of old versions to keep</source>
+        <translation>रखने हेतु पुराने पैकेज की संस्करण संख्या</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="102"/>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="183"/>
+        <source>Refresh</source>
+        <translation> रिफ्रेश करें</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/ui/cachecleaner.ui" line="127"/>
+        <source>Installed packages</source>
+        <translation>इंस्टॉल हो रखें पैकेज</translation>
+    </message>
+</context>
+<context>
+    <name>PackageGroupModel</name>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="199"/>
+        <source>Clean</source>
+        <translation>हटाएँ</translation>
+    </message>
+    <message>
+        <location filename="Projects/octopi/cachecleaner/packagegroupmodel.cpp" line="222"/>
+        <source>Clean %1</source>
+        <translation>%1 हटाएँ</translation>
+    </message>
+</context>
+</TS>